[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for pubi0:AAZ21667.1

[Show Plain Result]


## Summary of Sequence Search
    1::204
    1::125     4e-05  35%  201 aa  PF00657 Lipase_GDSL "GDSL-like Lipase/Acylhydrolase"
    1::204

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxVILFGDSLMAGYGLPQEKHLAIVLQNNLNDSGYDLGIIDGSVSGST
PF00657         ------------------------IVAFGDSLTDGNGGGWAAGLANRLSTCLNLPPYGVDVINFGVGGRT


                         .         .         *         .         .         .         .:140
query           SAGGLNRVEWSLSQPNIDLMILGLGANDMLRGISPIETEKNLEKIIQTAKLKNIEIILAGMIAPxxxxxx
PF00657         SDQQLARLKEALLALSPDLVIISIGTNDLLRGNSVEEFIANLRKLIKRLRANGARKIVVMNLPP------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00657         ----------------------------------------------------------------