[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for pubi0:AAZ21725.1

[Show Plain Result]


## Summary of Sequence Search
    1::388
    2::84      1e-24  55%   84 aa  PF08436 DXP_redisom_C "1-deoxy-D-xylulose 5-phosphate
    1::125     2e-13  35%  128 aa  PF02670 DXP_reductoisom "1-deoxy-D-xylulose 5-phosphate
    1::388

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxIAIFGSTGSIGSSLLKIIKDDQKNFKIELLTVNKNYKKLIKQVKLFNVKNVIVTDYNSFLITTKLLK
PF08436         ----------------------------------------------------------------------
PF02670         ---IVILGSTGSIGTQTLDVVRRHPDRFRVVALAAGSNVELLAEQAREFRPKYVAVADEEAAELKAALAA


                         .         .         *         .         .         .         .:140
query           NAKVKVFNNFDSLNKIFNTNNKIDYSMCAISGFDGLKPTLDIIKFTKTIAIANKESIIxxxxxxxxxxxx
PF08436         ----------------------------------------------------------------------
PF02670         GSNTEVLAGEEALVELAAL-PEADIVVNAIVGAAGLLPTLAAIKAGKTIALANKESLV------------


                         +         .         .         .         .         *         .:210
query           xxxxxVPVDSEHFSIWSLLDNNKKNNFEKIYITASGGPFRNLSLKKFRNISVKDALKHPNWSMGKKITID
PF08436         -----LPVDSEHSAIFQCLQGEPAGEVRRIILTASGGPFRDWPLEELANVTPEQALKHPNWSMGAKITID
PF02670         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           SATMMNKVFEIIEAKKIFxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08436         SATMMNKGLEVIEAHWLF----------------------------------------------------
PF02670         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08436         ----------------------------------------------------------------------
PF02670         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08436         --------------------------------------
PF02670         --------------------------------------