[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for pubi0:AAZ21732.1

[Show Plain Result]


## Summary of Sequence Search
    1::378
    1::346     1e-56  32%  368 aa  PF02684 LpxB "Lipid-A-disaccharide synthetase"
    1::378

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxIFILTGEPSGDKLASTVISKLKMNNPNIEYLSVGGTHIKKLGIKSIFDLKEITYLGFTSVLXXXXXX
PF02684         ---IFIVAGEASGDLLGAGLIRALKARYPDAEFVGVGGPRMQAEGLESLFDMEELAVMGLVEVLPRLPRL


                         .         .         *         .         .         .         .:140
query           XXXXXXTVEEIIKFNPDILFSVDSPDFTLRVAEKVXXXXXXXXXXXYVAPQVWVWRKNRVKKIKKFIDHI
PF02684         LKIRKELKRAILAEKPDVVILIDAPDFNLRLAKKLKKAGIKTVH--YVSPSVWAWRPGRIKKIAKAVDHV


                         +         .         .         .         .         *         .:210
query           LLLFNFEKKYFDEENIKNTFVGHPLIEKKDNVITSLDNLISKDKKIISLFPGSRKSETSVLLPILLNFIK
PF02684         LAILPFEPEFYEKHGVPATFVGHPLADEPDRAAAREKLGLDPDAPVIALLPGSRRSEIKRLLPVFLEAAQ


                         .         .         .         +         .         .         .:280
query           LMNKKKLDHLFVFHATDENKEFIINKVKKTNLDNIDIISDEDIKNQVLSNSIFAVSKSGTISLQISSANI
PF02684         LLLARYPDLQFVVPLANPKRREQIEQLLAEYGPDLSVVLIDGEKYEAMAAADAALAASGTATLEAALAGV


                         .         *         .         .         .         .         +:350
query           PSIIIYKLGFINFMIFKLLVNVRFANIINIINDKEVIPELLQKECNAEEIYKTVTYFLKNPELIEKQxxx
PF02684         PMVVAYKVSPLTYWIAKRLVKIPYISLPNILAGREVVPELLQEECTPENLAAALLELLEDPERREKQ---


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02684         ----------------------------