[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for pubi0:AAZ21799.1

[Show Plain Result]


## Summary of Sequence Search
    1::204
   10::108     5e-21  49%  108 aa  PF04367 DUF502 "Protein of unknown function (DUF502)"
    1::204

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF04367         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxVVGGLSLTFIGKKFLQIIDDLFKRMPILRTIYSAIGQMTDSFRAQEGNKKSVVLVEYPRKGSWAVGFA
PF04367         --LVGLLASNFLGRSLLGLGERLLKRIPLVRSIYSSVKQISETLSGDSSNSKKVVLVEYPRKGVYAIGFV


                         +         .         .         .         .         *         .:210
query           TKENTGEIKAKININLVNVFVPTTPNPTSGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF04367         TGTVPGELQAGLGEELVSVFVPTTPNPTSG----------------------------------