[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for pubi0:AAZ21850.1

[Show Plain Result]


## Summary of Sequence Search
    1::366
    1::194     1e-49  51%  194 aa  PF00926 DHBP_synthase "3,4-dihydroxy-2-butanone 4-phosphate
   15::166     2e-11  30%  169 aa  PF00925 GTP_cyclohydro2 "GTP cyclohydrolase II"
    1::366

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQAKR
PF00926         --------IEEAIEALRNGKMVIVVDDEDRENEGDLIIAAEAVTPEQIAFMIRHGSGLICLPLTEERADR
PF00925         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPGHVFPIIAKDGGV
PF00926         LGLPPMVTNNTDPHGTAFTVSVDAADGTTTGISAADRALTIRALADPDAKPEDFRRPGHVFPLRARDGGV
PF00925         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKHNLKIGKIEDLIAYRxxxxxxxx
PF00926         LERRGHTEAAVDLARLAGLKPAGVICEILNDDGTMARLPDLLAFAKKHGLKVITIEDLIEYR--------
PF00925         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxKYKIRIYENLLDGSEHFALIKGNIKKGIIPRVRVISSNVVQNYLINQQLPNSFDKTLN
PF00926         ----------------------------------------------------------------------
PF00925         ------------EFRLVGYRDLIDGKEHLALVKGDIDPDEPVLVRVHSECLTGDVFLRCDCGEQLDEALR


                         .         *         .         .         .         .         +:350
query           YFKKFNNCVLVFIKDTNLKSVTQTLKDYKNKNFYKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKKV
PF00926         ----------------------------------------------------------------------
PF00925         LIAEEGRGVLVYLRQEGRGGLLNKLKAY---NLQDLGLDTVARDYGLGAQILRDLGVKKIRLLTNNPDKI


                         .         .         .         .         *         .         .:420
query           IGLEGYDIKITKQxxx
PF00926         ----------------
PF00925         VALEGFGLEVVER---