[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for pubi0:AAZ21852.1

[Show Plain Result]


## Summary of Sequence Search
    1::351
    1::161     2e-12  30%  198 aa  PF01872 RibD_C "RibD C-terminal domain"
    7::81      2e-06  43%  100 aa  PF00383 dCMP_cyt_deam_1 "Cytidine and deoxycytidylate deaminase
    1::351

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MELALNLAKARHGLTGINPSVGCVIVKNNKILSIGQTGFKGTPHAEFNAIKNSHENIEGSKMYVTLEPCx
PF01872         ----------------------------------------------------------------------
PF00383         MRLALEAAERAYPCG--NFPVGAVLVDDGEIIATGYNGENATVHAEMNAILNAARKLTGYTLYVTLEPC-


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01872         ----------------------------------------------------------------------
PF00383         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           PYVTGKIAISKNNLIYSKDTKRISDIHTDRFTHFLRYKNDSLMISSKTLNKDDPKLNCRLEGLSKFSPKR
PF01872         PFVTLKLAMSLDGKIATPDSKWITGPEARADVHRLRARADAILVGRGTVLADDPSLTVRLPGGEPRQPPR
PF00383         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           IILDRNLEIKKNSYIFKTANKDNTIIFYYNAKAEVKLMLKKKGITLIKSKLNKNSFDIKSILMKLYVLGC
PF01872         VVLDSSLRLPPDARLV-TGGAPTLVVTTEKASKE-KLAELEELYVIADGKL-----DLAALLAKLKERGI
PF00383         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RNLLVEGGNDLSKHIIKKKLFNEFYLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01872         KSVLVEGGGTLAGSFLAAGLVDELIL--------------------------------------------
PF00383         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           x
PF01872         -
PF00383         -