[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for pubi0:AAZ21934.1

[Show Plain Result]


## Summary of Sequence Search
    1::247
    6::143     6e-20  35%  143 aa  PF00588 SpoU_methylase "SpoU rRNA Methylase family"
    1::75      2e-07  46%   77 aa  PF08032 SpoU_sub_bind "RNA 2'-O ribose methyltransferase
    1::247

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxLIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDKYTSKDQI
PF00588         ----------------------------------------------------------------------
PF08032         ------LIYGRHAVEEALRAGPRRILELYVTE------GRRDPRKEILKGVKVEEVSKKVLDKLS--DTV


                         .         .         *         .         .         .         .:140
query           MHGGYIAEVEHIDxxxxxxxxxxxxxxxxxxIDEVTDPRNIGSLIRSASSFHIDGLIVKERQFPSDSKLM
PF00588         -------------------------------LDNPQDPGNLGAIIRTAAAFGVDAVVVKPRCAPLDPKAL
PF08032         NHQGVVAVVKPLE---------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           YKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARGEKDFTEIKWEGKNVLLFGSEGFGMREHTGK
PF00588         -RASAGAHEHLPVIRVDDLEEALADLKEAGFRVVATDLEGARPLYEVDLPGPVALVFGNEGTGLSEEVLE
PF08032         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           YTDFFVKIDINKDVESLNISNSAAIVFHxxxxxxxxx
PF00588         LCDYLVRIPMAGGVDSLNVSVAAAILLY---------
PF08032         -------------------------------------