[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for pubi0:AAZ21946.1

[Show Plain Result]


## Summary of Sequence Search
    1::110
    7::60      1e-10  44%   60 aa  PF00462 Glutaredoxin "Glutaredoxin"
    1::110

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxPQCGFSMAVSNMLKILEVNYKGINVLESQSLREGIKEFSDWP
PF00462         ----------------------------PTCPFCVRAKELLKELGVEFEEVDVDEDPELREELKELSGWP


                         .         .         *         .         .         .         .:140
query           TIPQVYIKGEFVxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00462         TVPQVFIDGEHI----------------------------