[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for pubi0:AAZ21961.1

[Show Plain Result]


## Summary of Sequence Search
    1::337
    7::277     7e-40  36%  277 aa  PF00268 Ribonuc_red_sm "Ribonucleotide reductase, small chain"
    1::337

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxVYKPFRYPWCYDAWLTQQRIHWLPEEVPLGDDVRDWQKNLTQSE
PF00268         --------------------------LWNPIKYPWAWELYKKAEANFWLPEEIDLSRDIADWKK-LTEDE


                         .         .         *         .         .         .         .:140
query           KNLLTQIFRFFTQADVEVQNCYLRHYTTVFKPTEVLMMMTAFASMETVHIAAYSHLLDTIGMPESEYSAF
PF00268         RHFIKRVLAFFTLLDSLVENLVLALYRHITAP-EARAYLTRQAFMEAIHSKSYSYILETLGLDEEERDEI


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXXXXQNFDMSSKKDIALTVAVFSAFTEGLQLFASFAILLNFPRHNKMKGMGQIVTWSVRDE
PF00268         FNWIEENPALQKKAEWILKWYEDLAKKLIAF-AFLEGILFYSGFAAILALARRGKMPGTAEIIRLILRDE


                         .         .         .         +         .         .         .:280
query           TLHCNSMIRLFKEFIHENPEIWTPELKAELYKACRTIIEHEDAFIDLAFEMGPMQGLTAQDVKLYIRFIA
PF00268         SLHLNFGIYLINQLKEEEK----PE-KEEIYDLFREAVELEIEYAE-DFLPGGILGLNAEDVKQYVRYIA


                         .         *         .         .         .         .         +:350
query           NRRLSQLGLEPIYDVDKNPLTWxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00268         NRRLMNLGLEPLFPVENSPPPW-----------------------------------