[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for pubi0:AAZ22048.1

[Show Plain Result]


## Summary of Sequence Search
    1::333
    1::112     3e-05  32%  128 aa  PF00107 ADH_zinc_N "Zinc-binding dehydrogenase"
    1::333

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00107         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00107         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxGVGSIAVMILNKFGYDVTAVTGKAENEKYLRSLGAKNIINKADLDK
PF00107         ------------------------GVGLAAIQLAKALGARVIAVDRSPEKLELAKELGADHVINYKDEDE


                         .         .         .         +         .         .         .:280
query           DARPLDKGLWDGVVDTVGGKILANALAQTRDNGIVAACGNASDYKLNTTVMPFIIRGVKLWGxxxxxxxx
PF00107         AVKELTGGRVDVVLDCVGGATLEAALELLRPGGRVVLVGVPSGGPVTLPLGPLILKEITIRG--------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00107         -----------------------------------------------------