[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for pubi0:AAZ22059.1

[Show Plain Result]


## Summary of Sequence Search
    1::189
    2::165     3e-18  35%  193 aa  PF02525 Flavodoxin_2 "Flavodoxin-like fold"
    1::189

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxKIFLLYGHYNEKSFNAAIRDTFIKTAEKNGNTVDCVDLYKDKFNPVFAGEQAGEDVLDHRRRIEKCDI
PF02525         --KVLIIYAHPREGSFSSALNDAFVEALKEAGHEVTVRDLYAE-FDPVLDAAQGPADVESEQEELLWADV


                         .         .         *         .         .         .         .:140
query           IVLIAPIWNFRMPAIVEGWIDKVLSPPWAYTFKKLVGNYGYPMGNLKDKKAIIFCTYGSPRLAVTTFFLN
PF02525         IVFQFPLWWFSVPAILKGWIDRVFTAGFAFKYTE----NGPSGGLLKGKKALLIVTTGGPEEAYGEGLPG


                         +         .         .         .         .         *         .:210
query           LPIRRLKRGVFHMCGIYNIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02525         APMDDLLRGILGFCGITDL------------------------------