[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for pubi0:AAZ22091.1

[Show Plain Result]


## Summary of Sequence Search
    1::388
    1::362     6e-66  40%  364 aa  PF00465 Fe-ADH "Iron-containing alcohol dehydrogenase "
    1::388

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxTTMWVGENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGIIAALYSXXXX
PF00465         ---------TKIYFGKGALAELGEELKNLG-KRALIVTDGSLKKLGLLDKVLDSLKAAGIEVVVFDGVEP


                         .         .         *         .         .         .         .:140
query           XXXXXXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIWDFEDVGDNWTKANSDKIAPIIA
PF00465         NPTVETVEEGVALAREFGADVIIAVGGGSVIDAAKAIALLAENPGDVWDYEG-GDKPLKK---KALPLIA


                         +         .         .         .         .         *         .:210
query           VPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGLPAKMTAATGMDALAHNLEAYCA
PF00465         IPTTAGTGSEVTPFAVITDEEGGRKYGLADPALTPDVAILDPELTLTLPPRLTAATGMDALTHAIEAYVS


                         .         .         .         +         .         .         .:280
query           PGYHPMADGIALEGMRLIDKWLLEAVSNGSNIEARMNMLTAASMGSTAFQKGLGAIHSLSHPVNALNNIH
PF00465         TGANPITDALALKAIKLIFEYLPRAVADGEDLEARENMLLASTLAGMAFNAGLGAVHALAHPLGALFHIP


                         .         *         .         .         .         .         +:350
query           HGLSNAIFMPYVLTFNKDVIENKIIKICDYLELKDRSFDGFVNWVLDLRKKLDMPHKLSEVIDEKDFDID
PF00465         HGEANAILLPAVLRYNAPAAPERYARIARALGVDEEAAEALIEALRELFKSLGIPTTLSELVDEE--DID


                         .         .         .         .         *         .         .:420
query           RLSKMALADPSTGGNPKKLTEDxxxxxxxxxxxxxxxx
PF00465         ELAEAALEDQCTGNNPRELTPE----------------