[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for pubi0:AAZ22111.1

[Show Plain Result]


## Summary of Sequence Search
    1::284
   44::156     3e-09  37%  195 aa  PF01493 GXGXG "GXGXG motif"
    1::284

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01493         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFGMGSCDGPTVRINGRVGWSCAENLMAGKV
PF01493         ----------------------------------------FGAFLAGGLTIEVEGDANDYVGKGMSGGKI


                         +         .         .         .         .         *         .:210
query           VIEKNAGSCFGAAIRGGDLICKGSVGARTGIDMKGGTIIVGGDAGAFTGFMMQRGRIIILGDVGINLGDS
PF01493         VVRGNAGDGGKAEVNGGKLFVRGNAGERFGVRNSGATIVVEGNAGDHGGEYMTGGRVVVLGDTGRNFGAG


                         .         .         .         +         .         .         .:280
query           Mxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01493         M---------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxx
PF01493         ----