[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for pubi0:AAZ22162.1

[Show Plain Result]


## Summary of Sequence Search
    1::342
  140::245     9e-09  35%  271 aa  PF02653 BPD_transp_2 "Branched-chain amino acid transport system /
    1::342

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02653         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02653         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLSFGLAVITFITLKWAYSTRFGLILNAIRDNEDKAEAMG
PF02653         -------------------------------LALVLALLLWLLLR---RTRFGRALRAVGDNEEAARALG


                         .         .         .         +         .         .         .:280
query           IHTMRYKIIGWMVSAFFVGIAGGLMGHINGYIEPNEIAFAGPTFGVFMVLMAILGGKGTLWGPLVGAVLF
PF02653         INVDRVKLLAFALSGALAGLAGALLALRLGSASPS----MGFGLGLDAIAAVVLGGLGSILGAVLGALLL


                         .         *         .         .         .         .         +:350
query           HLFKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02653         GLLE----------------------------------------------------------