[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for pubi0:AAZ20846.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1e4eA2.bssp"
#ERROR : Can't open dsspfile "1iovA2.bssp"
#ERROR : Can't open dsspfile "1ehiA2.bssp"
#ERROR : Can't open dsspfile "1iovA1.bssp"
#ERROR : Can't open dsspfile "1vkzA3.bssp"
#ERROR : Can't open dsspfile "2pbzA2.bssp"
#ERROR : Can't open dsspfile "1bncA3.bssp"
#ERROR : Can't open dsspfile "1cqiB2.bssp"
#ERROR : Can't open dsspfile "1eyzA3.bssp"
#ERROR : Can't open dsspfile "1gsoA3.bssp"
#ERROR : Can't open dsspfile "1ehiA1.bssp"
#ERROR : Can't open dsspfile "1b6rA3.bssp"
#ERROR : Can't open dsspfile "1a9xA5.bssp"
#ERROR : Can't open dsspfile "1glvA2.bssp"
#ERROR : Can't open dsspfile "2bjqA1.bssp"
#ERROR : Can't open dsspfile "3eeqA1.bssp"
#ERROR : Can't open dsspfile "1a9xA6.bssp"
#ERROR : Can't open dsspfile "1e4eA1.bssp"
#ERROR : Can't open dsspfile "1w93A3.bssp"
#ERROR : Can't open dsspfile "1bncA2.bssp"

## Summary of PDB Search
:304
    1e-35  27%  1e4eA2 [d.142.1.1] VANCOMYCIN/TEICOPLANIN A-TYPE RESISTANCE PROTEIN
    4e-30  35%  1iovA2 [d.142.1.1] D-ALA\:D-ALA LIGASE A:97 -- 306
    1e-25  26%  1ehiA2 [d.142.1.1] D-ALANINE:D-LACTATE LIGASE A:135 -- 362
    2e-20  42%  1iovA1 [c.30.1.2] D-ALA\:D-ALA LIGASE A:1 -- 96
    4e-19  18%  1vkzA3 [d.142.1.2] PHOSPHORIBOSYLAMINE--GLYCINE LIGASE A:94 -- 313
    2e-18  11%  2pbzA2 [d.142.1.9] HYPOTHETICAL PROTEIN A:100 -- 312
    5e-17  16%  1bncA3 [d.142.1.2] BIOTIN CARBOXYLASE A:115 -- 330
    5e-17  12%  1cqiB2 [d.142.1.4] PROTEIN (SUCCINYL-COA SYNTHETASE BETA CHAIN) B:1
    7e-17  13%  1eyzA3 [d.142.1.2] PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2
    4e-16  15%  1gsoA3 [d.142.1.2] PROTEIN (GLYCINAMIDE RIBONUCLEOTIDE SYNTHETASE)
    2e-15  22%  1ehiA1 [c.30.1.2] D-ALANINE:D-LACTATE LIGASE A:3 -- 134
    5e-15  10%  1b6rA3 [d.142.1.2] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE
    2e-13  16%  1a9xA5 [d.142.1.2] CARBAMOYL PHOSPHATE SYNTHETASE (LARGE CHAIN)
    3e-13  11%  1glvA2 [d.142.1.1] GLUTATHIONE SYNTHASE A:123 -- 316
    5e-11  15%  2bjqA1 [b.169.1.1] MFP2A A:175 -- 344
    3e-10   5%  3eeqA1 [c.151.1.1] PUTATIVE COBALAMIN BIOSYNTHESIS PROTEIN G A:215
    2e-09  19%  1a9xA6 [d.142.1.2] CARBAMOYL PHOSPHATE SYNTHETASE (LARGE CHAIN)
    3e-08  34%  1e4eA1 [c.30.1.2] VANCOMYCIN/TEICOPLANIN A-TYPE RESISTANCE PROTEIN
    5e-05  20%  1w93A3 [d.142.1.2] ACETYL-COENZYME A CARBOXYLASE A:184 -- 450
    4e-04  15%  1bncA2 [c.30.1.1] BIOTIN CARBOXYLASE A:1 -- 114
:304

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTKKILILSGGISKERLISLDTGKQVAKELIKNGYKVLISEPDKNLSKNITSFKPDVIFNALHGQFGEDG
1e4eA2          ----------------------------------------------------------------------
1iovA2          ----------------------------------------------------------------------
1ehiA2          ----------------------------------------------------------------------
1iovA1          MTDKIAVLLGGTSAEREVSLNSGAAVLAGLREGGIDAYPVDPKEVDVTQLKSMGFQKVFIALHGRGGEDG
1vkzA3          ----------------------------------------------------------------------
2pbzA2          ----------------------------------------------------------------------
1bncA3          ----------------------------------------------------------------------
1cqiB2          ----------------------------------------------------------------------
1eyzA3          ----------------------------------------------------------------------
1gsoA3          ----------------------------------------------------------------------
1ehiA1          --KRVALIFGGNSSEHDVSKRSAQNFYNAIEATGIVFAIAQPLARIHALKSAGDFDIFFPVVHGNLGEDG
1b6rA3          ----------------------------------------------------------------------
1a9xA5          ----------------------------------------------------------------------
1glvA2          ----------------------------------------------------------------------
2bjqA1          ----------------------------------------------------------------------
3eeqA1          ----------------------------------------------------------------------
1a9xA6          ----------------------------------------------------------------------
1e4eA1          --IKVAILFGGCSEEHDVSVKSAIEIAANINKEKYEPLYIGITKSGVWKMCENHVDVAFSALHGKSGEDG
1w93A3          ----------------------------------------------------------------------
1bncA2          MLDKIVIANRGEI---------ALRILRACKELGIKTVAVHSSADRDLKHVLLADETVCIGPAPSVKSYL


                         .         .         *         .         .         .         .:140
query           YIQAILETKKIPYTHSGVIASSIAMDKEISKKIFIKNKILTPKYXXXXXXXXXXXXXXXXXXXXXFPVVV
1e4eA2          -------------------------DKSLTYIVAKNAGIATPAFWVINKDDRPVAATFT------YPVFV
1iovA2          --------------------------KLRSKLLWQGAGLPVAPWVALTRAEFEKGLSDKQLAEISLPVIV
1ehiA2          -------------------------DKALTKELLTVNGIRNTKYIVVDPESANNWSWDKIVAELGNIVFV
1iovA1          TLQGMLELMGLPYTGSGVMASALSMD--------------------------------------------
1vkzA3          --------------------------KVYAKRFXKKYGIRTARFEVAETPEELREKIKKFS----PPYVI
2pbzA2          -----------------------------------------------------------------RVEVV
1bncA3          -------------------------DKVSAIAAMKKAGVPCVPGSDGPLGDDMDKNRAI------AKRIG
1cqiB2          -----------------------NLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIG----AGPWV
1eyzA3          -------------------------REGIRRLAAEELQLPTSTYRFADSESLFREAVADIG----YPCIV
1gsoA3          --------------------------KAFTKDFLARHKIPTAEYQNFTEVEPALAYLREKG----APIVI
1ehiA1          TLQGLFKLLDKPYVGAPLRGHAVS----------------------------------------------
1b6rA3          -------------------------DRLTQKQLFDKLHLPTAPWQLLAERSEWPAVFDRLG----ELAIV
1a9xA5          -------------------------DRRRFDVAMKKIGLETARSGIAHTMEEALAVAADVG----FPCII
1glvA2          ------------------------------KLFTAWFSDLTPETLVTRNKAQLKAFWEKH-----SDIIL
2bjqA1          -----------------------------------------------------------------FPAAR
3eeqA1          ------------------KDVKMEEIRDGIYKVLERLNLKRERIGIIASIREEVKKIADEFN---VRFRL
1a9xA6          -----------------------------------------------------------------YPLVV
1e4eA1          SIQGLFELSGIPFVGCDIQSSAICM---------------------------------------------
1w93A3          -----------------------------------------------------------------FPVMI
1bncA2          NIPAIIS---------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KPINEGSSVHVYICDKTNILKNLKVLKSYNEILIEEFIPGREIQVAIMNNKSLGAIELEPRRKFYDYEAK
1e4eA2          KPARSGSSFGVKKVNSADELDYASARQYDSKILIEQAVSGCEVGCAVLGNSAALVVGEVDQRIHQEVEPE
1iovA2          KPSREGSSVGMSKVVAENALQDALAFQHDEEVLIEKWLSGPEFTVAILGEEILPSIRIQPSGTFYDYEAK
1ehiA2          KAANQGSSVGISRVTNAEEYTEADSFQYDYKVLIEEAVNGRELEVGVIGNDQPLVSEIGAHDGWYDYNNK
1iovA1          ----------------------------------------------------------------------
1vkzA3          KADGLARGKGVLILDSSKLIIGELIKGVKGPVVIDEFLAGNELSAXAVVNGRNFVILPFVRDYLXDGDRG
2pbzA2          EPEDAKPDELYFVRIEGSELEERERFIPGVYLYVHFFYSPILERLELLGVDERVLIADG----NARWPVK
1bncA3          YPVIIKRGMRVVRGDAELAQSISMTRAEAKMVYMEKYLENRHVEIQVLADGQGNAIYLAER---DCSMQR
1cqiB2          VK----CQVHEDIRAFLVTYQTDANGQPVNQILVEAATDIKELYLGAVVDRSSRRVVFMASTEIEKVAEE
1eyzA3          KPVMSSSGKGQTFIRSAEQLAQAQQGGRAGRVIVEGVVKFFEITLLTVSAVDGVHFC------APVGHRQ
1gsoA3          KAKGVIVAMTLEEAAAVHDMLAGNAFGDAGHRIIEEFLDGEEASFIVMGEHVLPMATSQDHKRVGDKDTG
1ehiA1          ----------------------------------------------------------------------
1b6rA3          KRRTGQWRLRANETEQLPAECY------GECIVEQGINFSGEVSLVGARGFDGSTVFY-----PLTHNLH
1a9xA5          RPSFTMGGSGGGIAYNREEFEEILDLSPTKELLIDESLIGKEYEMEVVRDKNDNCIIV-CSIENFDAMGI
1glvA2          KPLDASIFRVKEGDPNLGVIAETLTEHGTRYCMAQNYLPAKDGDKRVLVVDGEPVPYC------------
2bjqA1          NPI---AAGGRKVKSDDGTEMFQYVALWYEPVFGRAYPDSADKTLANFQENAGAEILVVPDPDILGFEYK
3eeqA1          VNEEEINNFMNPCLTPPSKTKGVIAGGRNSKLILRKIAISRNSTIAVATY--------------------
1a9xA6          RAAMEIVYDE---ADLRRYFQTAVLLDHFDAVEVDVDAICDGEMVLIG-----GIMEHIEQAGVHSGDS-
1e4eA1          ----------------------------------------------------------------------
1w93A3          KASEGGGGKGIRQVREEDFIALYHQAANESPIFIMKLAGRRHLEVQLLADQYGTNISL------FGRDCS
1bncA2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           YNSSAKTKHLIPVDLSKNNLAKITGIARAAHKIIGCKGVTRSDFKFFNGKFYLLEINTQPGMTKLSLVPE
1e4eA2          KGSE-NAVITVPADLSAEERGRIQETVKKIYKTLGCRGLARVDMFLQNGRIVLNEVNTLPGFTSYSRYPR
1iovA2          YLSDE-TQYFCPAGLEASQEANLQALVLKAWTTLGCKGWGRIDVMLDDGQFYLLEANTSPGMTSHSLVPM
1ehiA2          FVDNSAVHFQIPAQLSPEVTKEVKQMALDAYKVLNLRGEARMDFLLDNNVPYLGEPNTLPGFTNMSLFKR
1iovA1          ----------------------------------------------------------------------
1vkzA3          PNT-GGXGSWGPVEIPSDTIKKIEELFDKTLWGVEKEGYAYRGFLLHDGDPYILEYNVRLGDPETEVIVT
2pbzA2          PLPYT-IVGNRAIALRESLLPQLYDYGLAFVEPPGVIGPFALHF-AYDGSFKAIGIASRIDGGSNADHWY
1bncA3          RHQKV-VEEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQVE----HPV
1cqiB2          TPHLIHKVALDPLTGPMPYQGRAFKLGLEGKLVQQFTKIFMGLATIFERDLALIEINPLVITKQGDLICL
1eyzA3          EDGD-YRESWQPQQMSPLALERAQEIARKVVLALGGYGLFGVELFVCGDEVIFSEVSPRPHDT----GMV
1gsoA3          PNTG-GMGAYSPAPVVTDDVHRIIWPTVKGMAAEGNTGFLYAGLMIDQGNPKVIEFNCRFGDLETQPIML
1ehiA1          ----------------------------------------------------------------------
1b6rA3          QDGI-LRTSVAFPQANAQQQARAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNS----GHW
1a9xA5          HTGDS-ITVAPAQTLTDKEYQIMRNASMAVLREIGETGGSNVQFAVNNGRLIVIEMNPRVSRS--SALAS
1glvA2          -------LARGGGGEPRPLTESDWKIARQIGPTLKEKGLIFVGL--DIIGDRLTEINVTSPTC----IRE
2bjqA1          W---------------------------------------------------------------------
3eeqA1          ----------------------------------------------------------------------
1a9xA6          ------ACSLPAYTLSQEIQDVMRQQVQKLAFELQVRGLMNVQFAVKNNEVYLIEVNPRAART----VPF
1e4eA1          ----------------------------------------------------------------------
1w93A3          VRRHQKIIEEAPVTIAKAETHEMEKAAVRLGKLVGYVSAGTVEYLYDDGKFYFLELNP------------
1bncA2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           IAKHKGISFIKLIEWILKDASINR
1e4eA2          MMAAAGISLPELIDRLIVLA----
1iovA2          AARQAGMSFSQLVVRILELA----
1ehiA2          LWDYSDINNAKLVDMLIDYG----
1iovA1          ------------------------
1vkzA3          LN---PEGFVNAVLEGY-------
2pbzA2          SELYWGERL---------------
1bncA3          TEMITGVDLIKEQLRIAAG-----
1cqiB2          DGKLGDGNALFRQPDLMRDQSQ--
1eyzA3          TLISQDLSEFALHVRAF-------
1gsoA3          RM---KSDLVELCLAAC-------
1ehiA1          ------------------------
1b6rA3          TQNGASISQFELH-----------
1a9xA5          KATGFP-----IAKVAAKLA----
1glvA2          IEAEFPVSITGMLMDAIEARLQQQ
2bjqA1          ------------------------
3eeqA1          ------------------------
1a9xA6          VSKATGVPLAK-------------
1e4eA1          ------------------------
1w93A3          ------------------------
1bncA2          ------------------------