[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for pubi0:AAZ20908.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1xkpB1.bssp"
#ERROR : Can't open dsspfile "2p6rA2.bssp"
#ERROR : Can't open dsspfile "1oeyJ.bssp"
#ERROR : Can't open dsspfile "2oceA1.bssp"
#ERROR : Can't open dsspfile "2a1jB1.bssp"
#ERROR : Can't open dsspfile "1bqqT.bssp"
#ERROR : Can't open dsspfile "1z00B1.bssp"
#ERROR : Can't open dsspfile "1x2iA1.bssp"
#ERROR : Can't open dsspfile "1kftA.bssp"
#ERROR : Can't open dsspfile "1mu5A1.bssp"
#ERROR : Can't open dsspfile "2csbA4.bssp"
#ERROR : Can't open dsspfile "1ln0A.bssp"
#ERROR : Can't open dsspfile "1bvsA2.bssp"
#ERROR : Can't open dsspfile "2a1jA1.bssp"
#ERROR : Can't open dsspfile "1c7yA2.bssp"
#ERROR : Can't open dsspfile "2duyA1.bssp"
#ERROR : Can't open dsspfile "1dgsA1.bssp"
#ERROR : Can't open dsspfile "1u9lA.bssp"
#ERROR : Can't open dsspfile "2csbA3.bssp"
#ERROR : Can't open dsspfile "1pznA1.bssp"
#ERROR : Can't open dsspfile "1bgxT1.bssp"
#ERROR : Can't open dsspfile "1lb2B.bssp"
#ERROR : Can't open dsspfile "2eduA1.bssp"
#ERROR : Can't open dsspfile "2bskA1.bssp"
#ERROR : Can't open dsspfile "2axtU1.bssp"
#ERROR : Can't open dsspfile "1exnA1.bssp"
#ERROR : Can't open dsspfile "2q0zX1.bssp"
#ERROR : Can't open dsspfile "1qojA.bssp"

## Summary of PDB Search
:611
    3e-22  13%  1xkpB1 [d.198.1.1] CHAPERONE PROTEIN SYCN B:2 -- 122
    5e-17  12%  2p6rA2 [a.289.1.2] AFUHEL308 HELICASE A:489 -- 686
    2e-16   7%  1oeyJ  [d.15.2.2] NEUTROPHIL CYTOSOL FACTOR 4
    1e-14  18%  2oceA1 [a.60.2.6] HYPOTHETICAL PROTEIN PA5201 A:474 -- 563
    2e-13  17%  2a1jB1 [a.60.2.5] DNA EXCISION REPAIR PROTEIN ERCC-1 B:219 -- 296
    6e-13  11%  1bqqT  [b.40.3.1] METALLOPROTEINASE INHIBITOR 2
    2e-12  23%  1z00B1 [a.60.2.5] DNA REPAIR ENDONUCLEASE XPF B:823 -- 905
    2e-11  34%  1x2iA1 [a.60.2.5] HEF HELICASE/NUCLEASE A:2 -- 69
    4e-11  33%  1kftA  [a.60.2.3] EXCINUCLEASE ABC SUBUNIT C
    4e-11  21%  1mu5A1 [a.156.1.3] TYPE II DNA TOPOISOMERASE VI SUBUNIT B A:229 --
    4e-11  24%  2csbA4 [a.60.2.4] TOPOISOMERASE V A:465 -- 519
    4e-11  17%  1ln0A  [d.226.1.1] INTRON-ASSOCIATED ENDONUCLEASE 1
    1e-10  16%  1bvsA2 [a.60.2.1] PROTEIN (HOLLIDAY JUNCTION DNA HELICASE RUVA)
    2e-10  27%  2a1jA1 [a.60.2.5] DNA REPAIR ENDONUCLEASE XPF A:837 -- 898
    5e-10  18%  1c7yA2 [a.60.2.1] HOLLIDAY JUNCTION DNA HELICASE RUVA A:65 -- 150
    1e-09  17%  2duyA1 [a.60.2.7] COMPETENCE PROTEIN COMEA-RELATED PROTEIN A:11 --
    4e-08  24%  1dgsA1 [a.60.2.2] DNA LIGASE A:401 -- 581
    3e-07  12%  1u9lA  [a.60.4.2] TRANSCRIPTION ELONGATION PROTEIN NUSA
    6e-07  29%  2csbA3 [a.60.2.4] TOPOISOMERASE V A:410 -- 464
    7e-07  26%  1pznA1 [a.60.4.1] DNA REPAIR AND RECOMBINATION PROTEIN RAD51 A:35
    2e-06  27%  1bgxT1 [a.60.7.1] TAQ DNA POLYMERASE T:174 -- 289
    2e-06   7%  1lb2B  [a.60.3.1] DNA-DIRECTED RNA POLYMERASE ALPHA CHAIN
    3e-06  11%  2eduA1 [a.60.2.7] KINESIN-LIKE PROTEIN KIF22 A:8 -- 98
    3e-06  15%  2bskA1 [g.83.1.1] MITOCHONDRIAL IMPORT INNER MEMBRANE TRANSLOCASE
    1e-05  11%  2axtU1 [a.60.12.2] PHOTOSYSTEM II 12 KDA EXTRINSIC PROTEIN U:37 --
    3e-05  14%  1exnA1 [a.60.7.1] 5'-EXONUCLEASE A:186 -- 290
    3e-05  11%  2q0zX1 [a.289.1.1] PROTEIN PRO2281 X:33 -- 208
    9e-05  30%  1qojA  [a.2.9.1] UVRB
:611

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxPGVYRMLDHKDVILYVGKAKNLPNRLKSYVAEKNHIIRTARMLSQTFKL
1xkpB1          ----------------------------------------------------------------------
2p6rA2          ----------------------------------------------------------------------
1oeyJ           ----------------------------------------------------------------------
2oceA1          ----------------------------------------------------------------------
2a1jB1          ----------------------------------------------------------------------
1bqqT           -----------------------------------IVIRAKAVNKKEVDSGND--IYGNPIKRIQYEIK-
1z00B1          ----------------------------------------------------------------------
1x2iA1          ----------------------------------------------------------------------
1kftA           ----------------------------------------------------------------------
1mu5A1          ----------------------------------------------------------------------
2csbA4          ----------------------------------------------------------------------
1ln0A           ---------------------SGIYQIKNTLNNKVYVGSAKDFEKAWKRHFKDLEKGCHSSIKLQRSCSI
1bvsA2          ----------------------------------------------------------------------
2a1jA1          ----------------------------------------------------------------------
1c7yA2          ----------------------------------------------------------------------
2duyA1          ----------------------------------------------------------------------
1dgsA1          ----------------------------------------------------------------------
1u9lA           ----------------------------------------------------------------------
2csbA3          ----------------------------------------------------------------------
1pznA1          ----------------------------------------------------------------------
1bgxT1          ----------------------------------------------------------------------
1lb2B           ----------------------------------------------------------------------
2eduA1          ----------------------------------------------------------------------
2bskA1          ----------------------------------------------------------------------
2axtU1          ----------------------------------------------------------------------
1exnA1          ----------------------------------------------------------------------
2q0zX1          ----------------------------------------------------------------------
1qojA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           EIXXXXXXXXXXXXXXXXIKKHKPKFNILLKDDKSFPFVFISNKDQWAQVTKHRGKKDKEGFYFGPFASA
1xkpB1          ----------------------------------------------------------------------
2p6rA2          ----------------------------------------------------------------------
1oeyJ           ----------------------------------------------------------------------
2oceA1          ----------------------------------------------------------------------
2a1jB1          ----------------------------------------------------------------------
1bqqT           QIKMFKGPDQDIEFIYTAPAAAVCGVSLDIGGKKEY--LIAGKAEGNGNMHITLCD------FIVPWDTL
1z00B1          ----------------------------------------------------------------------
1x2iA1          ----------------------------------------------------------------------
1kftA           ----------------------------------------------------------------------
1mu5A1          ----------------------------------------------------------------------
2csbA4          ----------------------------------------------------------------------
1ln0A           LEEIPYEKDLIIERENFWIKELNSKINGYNIAD-------------------------------------
1bvsA2          ----------------------------------------------------------------------
2a1jA1          ----------------------------------------------------------------------
1c7yA2          ----------------------------------------------------------------------
2duyA1          ----------------------------------------------------------------------
1dgsA1          ----------------------------------------------------------------------
1u9lA           ----------------------------------------------------------------------
2csbA3          ----------------------------------------------------------------------
1pznA1          ----------------------------------------------------------------------
1bgxT1          ----------------------------------------------------------------------
1lb2B           ----------------------------------------------------------------------
2eduA1          ----------------------------------------------------------------------
2bskA1          ----------------------------------------------------------------------
2axtU1          ----------------------------------------------------------------------
1exnA1          ----------------------------------------------------------------------
2q0zX1          ----------------------------------------------------------------------
1qojA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GTANWTIKMLQKIFQIRVCDDSTFKNRKRPCILYQIKRCSGPCVDYIDKEDYKKSVDQAIQFVSGKSRDI
1xkpB1          ----------------------------------------------------------------------
2p6rA2          ----------------------------------------------------------------------
1oeyJ           ----------------------------------------------------------------------
2oceA1          ----------------------------------------------------------------------
2a1jB1          ----------------------------------------------------------------------
1bqqT           SAT--QKKSLNHRYQ-MGCECKITRCPMIPCYISSPDEC-------------------------------
1z00B1          ----------------------------------------------------------------------
1x2iA1          ----------------------------------------------------------------------
1kftA           ----------------------------------------------------------------------
1mu5A1          ----------------------------------------------------------------------
2csbA4          ----------------------------------------------------------------------
1ln0A           ----------------------------------------------------------------------
1bvsA2          ----------------------------------------------------------------------
2a1jA1          ----------------------------------------------------------------------
1c7yA2          ----------------------------------------------------------------------
2duyA1          ----------------------------------------------------------------------
1dgsA1          ----------------------------------------------------------------------
1u9lA           ----------------------------------------------------------------------
2csbA3          ----------------------------------------------------------------------
1pznA1          ----------------------------------------------------------------------
1bgxT1          ----------------------------------------------------------------------
1lb2B           ----------------------------------------------------------------------
2eduA1          ----------------------------------------------------------------------
2bskA1          ----------------ETCFLDCVKDFTTREVKPEETTCSEHCLQYLK----------MTQRISMRFQEY
2axtU1          ----------------------------------------------------------------------
1exnA1          ----------------------------------------------------------------------
2q0zX1          ----------------------------------------------------------------------
1qojA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           QKNLSKQMEEASEKLDFERASIFRDRIKSLNIIQSSQRINEANLIDADVIAAYKESGKTCIQVFFYRSKQ
1xkpB1          ----------------------------------------------------------------------
2p6rA2          ----------------------------------------------------------------------
1oeyJ           -EDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQREDIALNYDAEGDLVRLLSD----EDVALXVRQAR
2oceA1          ----------------------------------------------------------------------
2a1jB1          ----------------------------------------------------------------------
1bqqT           ----------------------------------------------------------------------
1z00B1          ----------------------------------------------------------------------
1x2iA1          ----------------------------------------------------------------------
1kftA           ----------------------------------------------------------------------
1mu5A1          ----------------------------------------------------------------------
2csbA4          ----------------------------------------------------------------------
1ln0A           ----------------------------------------------------------------------
1bvsA2          ----------------------------------------------------------------------
2a1jA1          ----------------------------------------------------------------------
1c7yA2          ----------------------------------------------------------------------
2duyA1          ----------------------------------------------------------------------
1dgsA1          ----------------------------------------------------------------------
1u9lA           ----------------------------------------------------------------------
2csbA3          ----------------------------------------------------------------------
1pznA1          ----------------------------------------------------------------------
1bgxT1          ----------------------------------------------------------------------
1lb2B           ----------------------------------------------------------------------
2eduA1          ----------------------------------------------------------------------
2bskA1          HIQQNEALAAKAGLL-------------------------------------------------------
2axtU1          ----------------------------------------------------------------------
1exnA1          ----------------------------------------------------------------------
2q0zX1          ----------------------------------------------------------------------
1qojA           ---LEGLXXQHAQNLEFEEAAQIRDQLHQL----------------------------------------


                         .         *         .         .         .         .         +:350
query           NWGNQAYFPKHDPDQSLSEIMSSFLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1xkpB1          ----------------------------------------------------------------------
2p6rA2          ----------------------------------------------------------------------
1oeyJ           GLPSQKRLFPWKLHITQKDNYRVYN---------------------------------------------
2oceA1          ----------------------------------------------------------------------
2a1jB1          ----------------------------------------------------------------------
1bqqT           ----------------------------------------------------------------------
1z00B1          ----------------------------------------------------------------------
1x2iA1          ----------------------------------------------------------------------
1kftA           ----------------------------------------------------------------------
1mu5A1          ----------------------------------------------------------------------
2csbA4          ----------------------------------------------------------------------
1ln0A           ----------------------------------------------------------------------
1bvsA2          ----------------------------------------------------------------------
2a1jA1          ----------------------------------------------------------------------
1c7yA2          ----------------------------------------------------------------------
2duyA1          ----------------------------------------------------------------------
1dgsA1          ----------------------------------------------------------------------
1u9lA           ----------------------------------------------------------------------
2csbA3          ----------------------------------------------------------------------
1pznA1          ----------------------------------------------------------------------
1bgxT1          ----------------------------------------------------------------------
1lb2B           ----------------------------------------------------------------------
2eduA1          ----------------------------------------------------------------------
2bskA1          ----------------------------------------------------------------------
2axtU1          ----------------------------------------------------------------------
1exnA1          ----------------------------------------------------------------------
2q0zX1          ----------------------------------------------------------------------
1qojA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGAMITFGNE
1xkpB1          ---------------------------------------------------------------------E
2p6rA2          -------------------------------------------------------------GFIFHDVLS
1oeyJ           ----------------------------------------------------------------------
2oceA1          ----------------------------------------------------------------------
2a1jB1          ----------------------------------------------------------------------
1bqqT           ----------------------------------------------------------------------
1z00B1          ----------------------------------------------------------------------
1x2iA1          ----------------------------------------------------------------------
1kftA           ----------------------------------------------------------------------
1mu5A1          ----------------------------------------------------------------------
2csbA4          ----------------------------------------------------------------------
1ln0A           ----------------------------------------------------------------------
1bvsA2          ----------------------------------------------------------------------
2a1jA1          ----------------------------------------------------------------------
1c7yA2          ----------------------------------------------------------------------
2duyA1          ----------------------------------------------------------------------
1dgsA1          ----------------------------------------------------------------------
1u9lA           ----------------------------------------------------------------------
2csbA3          ----------------------------------------------------------------------
1pznA1          ----------------------------------------------------------------------
1bgxT1          ----------------------------------------------------------------------
1lb2B           ----------------------------------------------------------------------
2eduA1          ----------------------------------------------------------------------
2bskA1          ----------------------------------------------------------------------
2axtU1          ----------------------------------------------------------------------
1exnA1          ----------------------------------------------------------------------
2q0zX1          ----------------------------------------------------------------------
1qojA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           GFVKKRYRKFDIKTKGNEQDDFAMLKEVLTRRFKRAMLEKGNYLTLPDLILIDGGKGQYSSAKEVLDEFG
1xkpB1          PIISHFCQDLGVPT----SSPLSPLIQLEMAQSGTLQLEQ-----HGATLTLWLARSRCEDAMVXALTLT
2p6rA2          RMELSDIGALHLICR--TPDMERLTVRKTDSWVEEEAFRLRKELSYYPSDFSVEYDWFLSEVKTALCLKD
1oeyJ           ----------------------------------------------------------------------
2oceA1          ----------------------------------------------------------------------
2a1jB1          ----------------------------------------------------------------------
1bqqT           ----------------------------------------------------------------------
1z00B1          ----------------------------------------------------------------------
1x2iA1          ----------------------------------------------------------------------
1kftA           ----------------------------------------------------------------------
1mu5A1          ----------------------------------------------------------------------
2csbA4          ----------------------------------------------------------------------
1ln0A           ----------------------------------------------------------------------
1bvsA2          ----------------------------------------------------------------------
2a1jA1          ----------------------------------------------------------------------
1c7yA2          ----------------------------------------------------------------------
2duyA1          ----------------------------------------------------------------------
1dgsA1          ----------------------------------------------------------------------
1u9lA           ----------------------------------------------------------------------
2csbA3          ----------------------------------------------------------------------
1pznA1          ----------------------------------------------------------------------
1bgxT1          ----------------------------------------------------------------------
1lb2B           ----------------------------------------------------------------------
2eduA1          ----------------------------------------------------------------------
2bskA1          ----------------------------------------------------------------------
2axtU1          ----------------------------------------------------------------------
1exnA1          ----------------------------------------------------------------------
2q0zX1          ----------------------------------------------------------------------
1qojA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           LHDLPMIAIAKGKLRNSGDETFFYKGKSFKFDKNDPTLFFMQRLRDEAHRFAITSHRAKRAKGITKSLLD
1xkpB1          AAALPLRAGWLGESQL---VLFVSLDERLTLPLLHQAFEQLLRLQQEV----------------------
2p6rA2          WIEEKDEDEICAKYGIAPGDLRRIV------ETAEWLSNAMNRIAEEVGNTSVSGLTERIKHGVKEELLE
1oeyJ           ----------------------------------------------------------------------
2oceA1          -------------------------------------HDVSQLKLARSLDAVVEDCVNAVGVDVNTALLA
2a1jB1          ---------------------------------------------------LLMEKLEQDFVSRVTECLT
1bqqT           ----------------------------------------------------------------------
1z00B1          ---------------------------------------------------SETLPESEKYNPGPQDFLL
1x2iA1          ---------------------------------------------------ALTLAERQR------LIVE
1kftA           ------------------------------------------------------------------SSLE
1mu5A1          -------------------------------------------YGVDREEIKILINNLKRDYTIKEFLVN
2csbA4          ------------------------------------------------------------------ASLI
1ln0A           ----------------------------------------------------------------------
1bvsA2          -----------------------------------------------------------AENRDLFLALL
2a1jA1          -----------------------------------------------------------------QDFLL
1c7yA2          -----------------------------------------------------------KQERTLFKELI
2duyA1          --------------------------------------------------------------------LX
1dgsA1          -------------------------------------------------------EESKHRGLERLLYAL
1u9lA           ----------------------------------------------------------------AIDTFT
2csbA3          ------------------------------------------------------------------AELT
1pznA1          --------------------------------------------------------------------IE
1bgxT1          --------------------------------------------------------------GDESDNLP
1lb2B           ------------------------------------------------------------------LRPV
2eduA1          ------------------------------------------------QKILDLLNEGSA------RDLR
2bskA1          ----------------------------------------------------------------------
2axtU1          -----------------------------------------EELVNVVDEKLGTAYGEKIDLNNNIAAFI
1exnA1          --------------------------------------------------------------GDLGDNIR
2q0zX1          --------------------------------------------------------------------LK
1qojA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           QIDGIGSIRKRALLNHFGSARAVESASFDEIKSVEGVEEKVAKKIYNFFHE
1xkpB1          ---------------------------------------------------
2p6rA2          RIRHIGRVRARKLYNAIRNAEDIVRHR---EKVASLIGRGIAERVVEGISV
1oeyJ           ---------------------------------------------------
2oceA1          RISGLNSTLAQNIVAHRDANGAF--RTRDELKKVSRLGEKTFEQAAGFLRV
2a1jB1          TVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHE
1bqqT           ---------------------------------------------------
1z00B1          KMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILG-NAANAKQLYDFIHT
1x2iA1          GLPHVSATLARRLLKHFGSVERVFTASVAELMKVEGIGEKIAKEIRRVITA
1kftA           TIEGVGPKRRQMLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIFWSLK-
1mu5A1          EFQSIGDTTADKILELAGPNKKVKNLTEEEITRLVE----TFKKYEDF---
2csbA4          SIRGIDRERAERLLKKYGGYSKVREAGVEELR-EDGLTDAQIRELKGL---
1ln0A           ---------------------------------------------------
1bvsA2          SVSGVGPRLAMATLAVHDARQALADSDVASLTRVPGIGRRGAERIVLELAD
2a1jA1          KMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGN-AANAKQLYDFIHT
1c7yA2          KTNGVGPKLALAILSGMQFVNAVEREEVGALVKLPGIGKKTAERLIVEMKD
2duyA1          ALPGIGPVLARRIVEGRPYA------RVEDLLKVKGIGPATLERLRPYLR-
1dgsA1          GLPGVGEVLARNLARRFGTMDRLLEASLEELIEVEEVGELTARAILETLKD
1u9lA           KYLDIDEDFATVLVEEFSTLEELAYVPMKELLEIEGLDEPTVEALRERAKN
2csbA3          KKEGVGRKTAERLLRAFGNKQLAREFEIEKLASVEGVGERVLRSL------
1pznA1          DLPGVGPATAEKLREGYDTLEAIAVASPIELKEVAGISEGTALKIIQAARK
1bgxT1          GVKGIGEKTARKLLEEWGSLEAL-------LKNLDRLKPAIREKILAHMDD
1lb2B           DDLELTVRSANCLKAEIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLAS
2eduA1          SLQRIGPKKAQLIVGWRELHGPF--SQVEDLERVEGITGKQMESFLK----
2bskA1          ---------------------------------------------------
2axtU1          QYRGLYPTLAKLIVKNAPYE------SVEDVLNIPGLTERQKQILRENLE-
1exnA1          GVEGIGAKRGYNIIREFGNVLDI-IDQLPLPG-KQKYIQNLNASEELLFRN
2q0zX1          QLPHFTSEHIKRCTDKVESVFDIXEXEDEERNALLQLTDSQIADVARFCNR
1qojA           ---------------------------------------------------