[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for pubi0:AAZ20910.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1a3gA.bssp"
#ERROR : Can't open dsspfile "1a0gA.bssp"
#ERROR : Can't open dsspfile "1et0A.bssp"
#ERROR : Can't open dsspfile "1ekfA.bssp"

## Summary of PDB Search
:293
    1e-70  36%  1a3gA  [e.17.1.1] BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE
    1e-65  25%  1a0gA  [e.17.1.1] D-AMINO ACID AMINOTRANSFERASE
    2e-65  21%  1et0A  [e.17.1.1] 4-AMINO-4-DEOXYCHORISMATE LYASE
    2e-59  22%  1ekfA  [e.17.1.1] BRANCHED CHAIN AMINO ACID AMINOTRANSFERASE
:293

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxKRSGKIWFNGELVDWADAKIHVLNHGLHYASCVFEGERVYDNSIFKLEEHTSRLFYSAKRMGIKI
1a3gA           ------KADYIWFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHVFRHREHMQRLHDSAKIYRFPV
1a0gA           --------GYTLWNDQIVKDEEVKIDKEDRGYQFGDGVYEVVKVYNGEMFTVNEHIDRLYASAEKIRITI
1et0A           ----------FLING----HKQESLAVSDRATQFGDGCFTTARVIDGKVSLLSAHIQRLQDACQRLMISC
1ekfA           -----EWNDKGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKAFKGKLFRPWLNMDRMLRSAMRLCLPS


                         .         .         *         .         .         .         .:140
query           PYTEEEINLASKKIISVQGVKDGYVRPTIWRGSEMMAISAQQTKIHVAIATWEWGSYFDPKLKIEGIKLN
1a3gA           SQSIDELMEACRDVIRKNNLTSAYIRPLIFVGDVGMGVNPAGYSTDVIIAAFPW----------QGIDAM
1a0gA           PYTKDKFHQLLHELVEKNELNTGHIYFQVTRGTSPRAHQFPENTVKPVIIGYTKENPRPLENLEKGVKAT
1et0A           DFWPQLEQEMKT---LAAEQQNGVLKVVISRGSGGRGYSTLNSGPATRILSVT------------AITLA
1ekfA           FDKLELLECVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQPRRAL-LFVILCPVGAYFPGGSVTPVSLLA


                         +         .         .         .         .         *         .:210
query           ISNWRRPAPNTIPWDTKASGLYMICTLSKHEAEQQGYTDSLMLDHEGNVAEATGANIFFKDKNGEIHTPI
1a3gA           VSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGYQEGIALDVNGYISEGAGENLFEV-KDGVLFTPP
1a0gA           FVEDIRWLRCDI-----KSLNLLGAVLAKQEAHEKGCYEAI-LHRNNTVTEGSSSNVFGI-KDGILYTHA
1et0A           LSPVRLGRNPHLA--GIKHLNRLEQVLIRSHLEQTNADEALVLDSEGWVTECCAANLFWR-KGNVVYTPR
1ekfA           DPAFIRAWVGGVG-NYKLGGNYGPTVLVQQEALKRGCEQVLWLYGPHQLTEVGTMNIFVEDGVLELVTPP


                         .         .         .         +         .         .         .:280
query           PDSFLDGITRRTVIEIAKSKGIKVNERKIAPAELSNFVGCFLTGTAAEVTPVSCIAENKFKVCETIIDLN
1a3gA           FTSALPGITRDAIIKLAKELGIEVREQVLSRESLYLADEVFMSGTAAEITPVRSVDGIQVRCGPVTKRIQ
1a0gA           NNMIAKGITRDVVIACANEINMPVKEIPFTTHEALKMDELFVTSTTSEITPVIEIDGKLIKVGEWTRKLQ
1et0A           LDAGVNGIMRQFCIRLLAQSSYQLVEVQASLEESLQADEMVICNALMPVMPVCACGDVSFSSATLYEYLA
1ekfA           LNVILPGVVRQSLLDMAQTWGFRVVERTITMKQLGRVREVFGSGTACQVCPVHRILYKDRNLHELILRFQ


                         .         *         .         .         .         .         +:350
query           ESYQALVRKRKAx
1a3gA           QAFFGLFTGETE-
1a0gA           KQFETKIPK----
1et0A           PLCE---------
1ekfA           KELKEIQYGI---