[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for pubi0:AAZ21022.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1bgxT4.bssp"
#ERROR : Can't open dsspfile "1skrA2.bssp"
#ERROR : Can't open dsspfile "2hbjA2.bssp"
#ERROR : Can't open dsspfile "1exnA2.bssp"
#ERROR : Can't open dsspfile "1q40B.bssp"
#ERROR : Can't open dsspfile "1d8yA1.bssp"
#ERROR : Can't open dsspfile "1a76A2.bssp"
#ERROR : Can't open dsspfile "1yt3A3.bssp"
#ERROR : Can't open dsspfile "1tfrA2.bssp"
#ERROR : Can't open dsspfile "1exnA1.bssp"
#ERROR : Can't open dsspfile "1l3sA1.bssp"
#ERROR : Can't open dsspfile "1i3qH.bssp"
#ERROR : Can't open dsspfile "1bgxT1.bssp"
#ERROR : Can't open dsspfile "1skrA1.bssp"
#ERROR : Can't open dsspfile "1ul1X1.bssp"
#ERROR : Can't open dsspfile "2i5hA1.bssp"
#ERROR : Can't open dsspfile "1dgsA1.bssp"
#ERROR : Can't open dsspfile "1vk0A.bssp"
#ERROR : Can't open dsspfile "1a76A1.bssp"
#ERROR : Can't open dsspfile "2j9uB1.bssp"
#ERROR : Can't open dsspfile "1z00B1.bssp"
#ERROR : Can't open dsspfile "1j53A.bssp"
#ERROR : Can't open dsspfile "2a1jA1.bssp"
#ERROR : Can't open dsspfile "1keaA.bssp"
#ERROR : Can't open dsspfile "2csbA4.bssp"
#ERROR : Can't open dsspfile "1d5aA1.bssp"
#ERROR : Can't open dsspfile "1bgxT2.bssp"

## Summary of PDB Search
:924
    e-126  41%  1bgxT4 [e.8.1.1] TAQ DNA POLYMERASE T:423 -- 832
    5e-96  21%  1skrA2 [e.8.1.1] DNA POLYMERASE A:211 -- 704
    7e-42  12%  2hbjA2 [c.55.3.5] EXOSOME COMPLEX EXONUCLEASE RRP6 A:129 -- 420
    1e-36  21%  1exnA2 [c.120.1.2] 5'-EXONUCLEASE A:20 -- 185
    2e-35  10%  1q40B  [d.17.4.2] MRNA EXPORT FACTOR MEX67
    2e-34  42%  1d8yA1 [c.55.3.5] DNA POLYMERASE I A:324 -- 518
    1e-29  16%  1a76A2 [c.120.1.2] FLAP ENDONUCLEASE-1 PROTEIN A:2 -- 208
    3e-28  17%  1yt3A3 [c.55.3.5] RIBONUCLEASE D A:1 -- 193
    8e-28  21%  1tfrA2 [c.120.1.2] T4 RNASE H A:12 -- 180
    7e-25  20%  1exnA1 [a.60.7.1] 5'-EXONUCLEASE A:186 -- 290
    1e-24  18%  1l3sA1 [c.55.3.5] DNA POLYMERASE I A:297 -- 468
    2e-24  11%  1i3qH  [b.40.4.8] DNA-DIRECTED RNA POLYMERASE II 14.5KD
    3e-24  38%  1bgxT1 [a.60.7.1] TAQ DNA POLYMERASE T:174 -- 289
    4e-22  14%  1skrA1 [c.55.3.5] DNA POLYMERASE A:1 -- 210
    4e-21  23%  1ul1X1 [a.60.7.1] FLAP ENDONUCLEASE-1 X:218 -- 357
    1e-20  12%  2i5hA1 [e.71.1.1] HYPOTHETICAL PROTEIN AF1531 A:16 -- 195
    6e-15  15%  1dgsA1 [a.60.2.2] DNA LIGASE A:401 -- 581
    4e-14  10%  1vk0A  [c.55.3.5] HYPOTHETICAL PROTEIN
    8e-13  32%  1a76A1 [a.60.7.1] FLAP ENDONUCLEASE-1 PROTEIN A:209 -- 316
    1e-12   7%  2j9uB1 [g.41.11.1] VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 36
    2e-12  11%  1z00B1 [a.60.2.5] DNA REPAIR ENDONUCLEASE XPF B:823 -- 905
    8e-10  12%  1j53A  [c.55.3.5] DNA POLYMERASE III, EPSILON CHAIN
    9e-06  21%  2a1jA1 [a.60.2.5] DNA REPAIR ENDONUCLEASE XPF A:837 -- 898
    1e-04  20%  1keaA  [a.96.1.2] POSSIBLE G-T MISMATCHES REPAIR ENZYME
    3e-04  31%  2csbA4 [a.60.2.4] TOPOISOMERASE V A:465 -- 519
    4e-04  22%  1d5aA1 [c.55.3.5] PROTEIN (DNA POLYMERASE) A:1 -- 347
    5e-04  35%  1bgxT2 [c.120.1.2] TAQ DNA POLYMERASE T:1 -- 173
:924

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxDHFYLIDGSGYIFRAYYALPPLTRKSDGLPVGAVSGFCSMLFKLLEDSKSNENLQKPTHFAVI
1bgxT4          ----------------------------------------------------------------------
1skrA2          ----------------------------------------------------------------------
2hbjA2          ----------------------------------------------------------------------
1exnA2          --------NLXIVDGTNLGFRFKHNNS-------KKPFAS--SYVSTIQSLAKS-------YSARTTIVL
1q40B           ----------------------------------------------------------------------
1d8yA1          ----------------------------------------------------------------------
1a76A2          -----------AIDGMNALYQFLTSIRSPLRNRKGEITSAYNGVFYKTIHLLEN---------DITPIWV
1yt3A3          ----------------------------------------------------------------------
1tfrA2          -------EGICLIDFSQIALSTALVNFPDKKINLSMVRHLILNSIKFNVKKAKTLG-------YTKIVLC
1exnA1          ----------------------------------------------------------------------
1l3sA1          ----------------------------------------------------------------------
1i3qH           ----------------------------------------------------------------------
1bgxT1          ----------------------------------------------------------------------
1skrA1          ----------------------------------------------------------------------
1ul1X1          ----------------------------------------------------------------------
2i5hA1          ----------------------------------------------------------------------
1dgsA1          ----------------------------------------------------------------------
1vk0A           ----------------------------------------------------------------------
1a76A1          ----------------------------------------------------------------------
2j9uB1          --------------------------------------------------------------------ST
1z00B1          ----------------------------------------------------------------------
1j53A           ----------------------------------------------------------------------
2a1jA1          ----------------------------------------------------------------------
1keaA           ----------------------------------------------------------------------
2csbA4          ----------------------------------------------------------------------
1d5aA1          ----------------------------------------------------------------------
1bgxT2          -----------LVDGHHLAYRTFHALKGLTTS-RGEPVQAVYGFAKSLLK--------ALKEDGDAVIVV


                         .         .         *         .         .         .         .:140
query           FDAARKTFRNEIYSDYKANRSEAPDDLAPQFEYIRKSVVAFNLPSVDLPNYEADDLIATYVEQILAKGAK
1bgxT4          ----------------------------------------------------------------------
1skrA2          ----------------------------------------------------------------------
2hbjA2          ----------------------------------------------------------------------
1exnA2          GDKGKSVFRLEHLPEYKGNRDEKYAQRTEEEKALDEQLCKTTFPTFTIRGVEADDXAAYIVKLIGHLYDH
1q40B           ----------------------------------------------------------------------
1d8yA1          ----------------------------------------------------------------------
1a76A2          FDGEPPKLKEKTFEEAAKYAKRVSYLTPKMVENCKYLLSLMGIPYVEAP-SEGEAQASYMAK----KGDV
1yt3A3          ----------------------------------------------------------------------
1tfrA2          IDNAKSGYWRRDFAYYYKKTWDWEGYFESSHKVIDELKAYMPYIVMDIDKYEADDHIAVLVKKFSLEGHK
1exnA1          ----------------------------------------------------------------------
1l3sA1          ----------------------------------------------------------------------
1i3qH           ----------------------------------------------------------------------
1bgxT1          ----------------------------------------------------------------------
1skrA1          ----------------------------------------------------------------------
1ul1X1          ----------------------------------------------------------------------
2i5hA1          --------DYAYVLDFMPYG-----HPDDKRPIHRREPLAQVVGERNFTLLEVSIRKGKQP----LVMDR
1dgsA1          -----------------------------ACPECGHRLVKEGKVHRCPNPLCPAKRFEAIRHYASRKAMD
1vk0A           ----------------------------------------------------------------------
1a76A1          ----------------------------------------------------------------------
2j9uB1          WVCPICMVSNETQGEFTKDTLPTPICINCGVPADYELTKS------------------------------
1z00B1          ----------------------------------------------------------------------
1j53A           ----------------------------------------------------------------------
2a1jA1          ----------------------------------------------------------------------
1keaA           ----------------------------------------------DFPWRHTRDPYVILITEILLRRTT
2csbA4          ----------------------------------------------------------------------
1d5aA1          ----------------------------------------------------------------------
1bgxT2          FDAKAPSFRHEAYGGYKAGRAPTPEDFPRQLALIKELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYE


                         +         .         .         .         .         *         .:210
query           VTIVSSDKDLMQLYRKDVRIFDPMKNKFITPEDIVTKFGVGPEKVIDVQSLAGDSSDNVPGVPGIGVKTA
1bgxT4          ----------------------------------------------------------------------
1skrA2          ----------------------------------------------------------------------
2hbjA2          ----------------------------------------------------------------------
1exnA2          VWLISTDGDWDTLLTDKVSRFSFTTRREYHLRDXYEHH--------------------------------
1q40B           ----------------------------------------------------------------------
1d8yA1          ----------------------------------------------------------------------
1a76A2          WAVVSQDYDALLYGAPRVVRNLTTTKELIELNEVLEDL--------------------------------
1yt3A3          ----------------------------------------------------------------------
1tfrA2          ILIISSDGDFTQLHKYPNVKWSPMHKK-------------------------------------------
1exnA1          -----------------------------------------VEQFISLKAIXGDLGDNIRGVEGIGAKRG
1l3sA1          ----------------------------------------------------------------------
1i3qH           ----------------------------------------------------------------------
1bgxT1          ---------------------------------------LRPDQWADYRALTGDESDNLPGVKGIGEKTA
1skrA1          ----------------------------------------------------------------------
1ul1X1          ---------------------------------------LNQEQFVDLCILLG--SDYCESIRGIGPKRA
2i5hA1          VYIGKGERDVVYKIKRRLRYEDLTPAAKTELPYVIEIKQDEKKYVDFFNDSITTRMHQLELLPGVGKKMM
1dgsA1          IEGLGEKLIERLLEKGLVRLYHLRKEDLLGLERMGEKAQNLLRQIEESKHRGLERLLYALGLPGVGEVLA
1vk0A           ----------------------------------------------------------------------
1a76A1          -----------------------------------------LDDLIDIAIFMG-TDYNPGGVKGIGFKRA
2j9uB1          ----------------------------------------------------------------------
1z00B1          -----------------------------------------SETLPESEKYNPGPQDFLLKMPGVNAKNC
1j53A           ----------------------------------------------------------------------
2a1jA1          -------------------------------------------------------QDFLLKMPGVNAKNC
1keaA           AGHVK-------------KIYDKFFVKYKCFEDILKEIGLSNQRAEQLKELARRNRKAILDLPGVGKYTC
2csbA4          ------------------------------------------------------------SIRGIDRERA
1d5aA1          ----------------------------------------------------------------------
1bgxT2          VRILTADKDLYQLLSDRIHVLHPEGYLI-TPAWLWEKYG-------------------------------


                         .         .         .         +         .         .         .:280
query           AELINKYGTLEKLLDNAQEIKQNKRRETLIENKDKAIISKKLVTLMKDAPVERKLEEFHLKKIDKNKLYK
1bgxT4          ----------------------------------------------------------------------
1skrA2          ----------------------------------------------------------------------
2hbjA2          ------------------EKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDNNPSHYPHP
1exnA2          ----------------------------------------------------------------------
1q40B           ----------------------------------------------------------------------
1d8yA1          ----------------------------------------------------------------------
1a76A2          ----------------------------------------------------------------------
1yt3A3          ----------------------------------------------------------------------
1tfrA2          ----------------------------------------------------------------------
1exnA1          YNIIREFGNVLDIIDQLPLPGKQKYIQNLNASEELLFRNLILVDLPTYCVDAIAAVGQDVLDKFTKDILE
1l3sA1          ----------------------------------------------------------------------
1i3qH           ----------------------------------------------------------------------
1bgxT1          RKLLEEWGSLEALLKNLDRLKP-AIREKILAHMDDLKLSWDLAKVRTDLPLEVDFAK--RREPDRERLRA
1skrA1          ----------------------------------------------------------------------
1ul1X1          VDLIQKHKSIEEIVRRLDPNKYPVPENWLHKEAHQLFLEPEVLDP--------ESVELKWSEPNEEELIK
2i5hA1          WAIIEERK--KRPFESFEDIAQRVKIQRPEKLIVSRIIYEIKNPQTKYK---------------------
1dgsA1          RNLARRFGTMDRLLEASLE---------------------------------------------------
1vk0A           ----------------------------------------------------------------------
1a76A1          YELVRSGVAKDVLKKEVEYYDEIKR-------------------IFKEPKVTDN-YSLSLKLPDKEGIIK
2j9uB1          ----------------------------------------------------------------------
1z00B1          RSLMHHVKNIAELAASQDELTSILGNAANAK-QLYDFIHTSFAEVVSKGKGKK-----------------
1j53A           ----------------------------------------------------------------------
2a1jA1          RSLMHHVKNIAELAALSQD---------------------------------------------------
1keaA           AVMCLAFGKKAAMVD--ANFVRVINRYFGGSYENLNYNHKALWELAETLVPGGKCRDFNLGLMDFSAII-
2csbA4          ERLLKKYGGYSKVREAGVE---------------------------------------------------
1d5aA1          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           FLREMEFNRLLSSVISAYGEPLLXXXXXXXXXXXXHQNISKKNYHLITNEKEIDEWINEAEEAGELAIDT
1bgxT4          ----------------------------------------------------------------------
1skrA2          ----------------------------------------------------------------------
2hbjA2          YEYEIDHQEYSPEILQIREEIPS-------------KSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDL
1exnA2          ----------------------------------------------------------------------
1q40B           ----------------------------------------------------------------------
1d8yA1          --------------------------------------ISYDNYVTILDEETLKAWIAKLEKAPVFAFAT
1a76A2          ----------------------------------------------------------------------
1yt3A3          ------------------------------------------NYQMITTDDALASLCEAVRAFPAIALDT
1tfrA2          ----------------------------------------------------------------------
1exnA1          IA--------------------------------------------------------------------
1l3sA1          ----------------------------------------------KMAFTLADRVTEEMLA-DKAALVV
1i3qH           ----------------------------------------------------------------------
1bgxT1          FLERLEFGSLL-----------------------------------------------------------
1skrA1          -----------------------------------------------------------------IVSDI
1ul1X1          FMGEKQFSE-------------------------------------------------------------
2i5hA1          ----------------------------------------------------------------------
1dgsA1          ----------------------------------------------------------------------
1vk0A           ---------------------------------------------ASFDGPKF-KXTDGSYVQTKTIDVG
1a76A1          FLDENDFNY-------------------------------------------------------------
2j9uB1          ----------------------------------------------------------------------
1z00B1          ----------------------------------------------------------------------
1j53A           -----------------------------------------------------------------IVLDT
2a1jA1          ----------------------------------------------------------------------
1keaA           ----------------------------------------------------------------------
2csbA4          ----------------------------------------------------------------------
1d5aA1          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           ETSSLDAHQTDLVGISLSTKIGQACYIPIGHKFKGCLKKETVIKKLKPLLEDKSVKKIGQNIKFDFIVLY
1bgxT4          ----------------------------------------------------------------------
1skrA2          ----------------------------------------------------------------------
2hbjA2          EHHDYRSYYGIVCLMQISTRERDYLVDTLKLREN--------LHILNEVFTNPSIVKVFHGAFMDIIWLQ
1exnA2          ----------------------------------------------------------------------
1q40B           ----------------------------------------------------------------------
1d8yA1          ATDSLDNISANLVGLSFAIEPGVAAYIPVAHDYLDAISRERALELLKPLLEDEKALKVGQNLKYDRGILA
1a76A2          ----------------------------------------------------------------------
1yt3A3          EFVRTRTYYPQLGLIQLFDGEHLALIDPLGIT---------DWSPLKAILRDPSITKFLHAGSEDLEVFL
1tfrA2          ----------------------------------------------------------------------
1exnA1          ----------------------------------------------------------------------
1l3sA1          EVVEENYHDAPIVGIAVVNEHGRFFLRPETAL---------ADPQFVAWLGDETKKKSMFDSKRAAVALK
1i3qH           ----------------------------------------------------------------------
1bgxT1          ----------------------------------------------------------------------
1skrA1          EANALLESVTKFHCGVIYDYSTAEYVSYRPSDF------GAYLDALEAEVARGGLIVFHNGHKYDVPALT
1ul1X1          ----------------------------------------------------------------------
2i5hA1          ----------------------------------------------------------------------
1dgsA1          ----------------------------------------------------------------------
1vk0A           SSTDISPYLSLIREDSILNGNRAVSSVKLSTFLRLPKPFHDNLKDLYRFFASKFVTFVGVQIEEDLDLLR
1a76A1          ----------------------------------------------------------------------
2j9uB1          ----------------------------------------------------------------------
1z00B1          ----------------------------------------------------------------------
1j53A           ETTGMNQIGAHYEGIEIGAVEVVNRRLTGNNFLLDKPTFAEVADEFMDYIRG--AELVIHNAAFDIGFMD
2a1jA1          ----------------------------------------------------------------------
1keaA           ----------------------------------------------------------------------
2csbA4          ----------------------------------------------------------------------
1d5aA1          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           KQGINMNSMEDTMLMSYVLDAGKNRHNMDTLSEIHLQHKTISFKEIVGTGKKEINFSDVELDKAMEYAAE
1bgxT4          ----------------------------------------------------------------------
1skrA2          --------------------------------------------------KQERNGFPFDTKAIEELYVE
2hbjA2          RDLGLYVGLFDTYHASKAIGLP--RHSLAYLLENFANFKTSKKYQLADWRIRPL------SKPMTAAARA
1exnA2          ----------------------------------------------------------------------
1q40B           ----------------------------------------------------------------------
1d8yA1          NYGIELRGAFDTMLESYILNSVAGRHDMDSLAERWLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAE
1a76A2          ----------------------------------------------------------------------
1yt3A3          NVFGELQPLIDTQILAAFCGRPM-SWGFASMVEEYSGVTLDKSESRTDWLARPLT------ERQCEYAAA
1tfrA2          ----------------------------------------------------------------------
1exnA1          ----------------------------------------------------------------------
1l3sA1          WKGIELGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRA---VPDEPVLAEHLVR
1i3qH           ---------------------------------------NTLFDDIFQSEVDPGRYNKVCRIEAASTTQD
1bgxT1          ----------------------------------------------------------------------
1skrA1          KLHLPRENCIDTLVLSRLIHSNLKDTDMGLLRSGKLPGALEAWGYRLGEMKGEYKDWWNFNEEMMDYNVQ
1ul1X1          ----------------------------------------------------------------------
2i5hA1          ----------------------------------------------------------------------
1dgsA1          ----------------------------------------------------------------------
1vk0A           ENGLVIRNAVGKLAAEARGTLVLEFLGTRELAHRVLWSDLGQLDSIEAKWEKAGPEEQL------EAAAI
1a76A1          ----------------------------------------------------------------------
2j9uB1          ----------------------------------------------------------------------
1z00B1          ----------------------------------------------------------------------
1j53A           YE------FSLLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCAR------YEIDNSKRTLHGALL
2a1jA1          ----------------------------------------------------------------------
1keaA           ----------------------------------------------------------------------
2csbA4          ----------------------------------------------------------------------
1d5aA1          ----------------------KGRIHFDLYPVIRRTINLPTYTPVFGQPAEKVYAEEIGLERVARYSME
1bgxT2          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           DADITYRLYKIFSKNLKLEKLTNIYEIFEKPLIKILAFMEIEGIKIDNKFLKVLSEKFEKKISKLEKEVF
1bgxT4          ------------------ERLLWLYREVERPLSAVLAHMEATGVRLDVAYLRALSLEVAEEIARLEAEVF
1skrA2          LAARRSEL---------LRKLTETFGSWYQPKGGTEMFCHPRTGKPLPKYPRIKTPKVIDTREYVAGAPY
2hbjA2          DTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPIE--------------
1exnA2          ----------------------------------------------------------------------
1q40B           ------------------------RNL-ATNFIANYLKLW----DANRSELXILYQNES-----QFSXQV
1d8yA1          DADVTLQLHLKMWPDLQ-----------------------------------------------------
1a76A2          ----------------------------------------------------------------------
1yt3A3          DVWYLLPITAKLMVETASGWLPAALDECRLMQMR------------------------------------
1tfrA2          ----------------------------------------------------------------------
1exnA1          ----------------------------------------------------------------------
1l3sA1          KAAAIWELERPFLDELR-----------------------------------------------------
1i3qH           QCKLTLDINVELFPVAAQDSL-------TVTIASSLTRSWRPPQAGDRSLADDYDYKFEEVSKDLIAVYY
1bgxT1          ----------------------------------------------------------------------
1skrA1          DVVVTKALLEKLLSDKHFPPEIDFTDVGYTTF--------------------------------------
1ul1X1          ----------------------------------------------------------------------
2i5hA1          ----------------------------------------------------------------------
1dgsA1          ----------------------------------------------------------------------
1vk0A           EGWLIVNVWDQL----------------------------------------------------------
1a76A1          ----------------------------------------------------------------------
2j9uB1          ----------------------------------------------------------------------
1z00B1          ----------------------------------------------------------------------
1j53A           DAQILAEVYLAM----------------------------------------------------------
2a1jA1          ----------------------------------------------------------------------
1keaA           ----------------------------------------------------------------------
2csbA4          ----------------------------------------------------------------------
1d5aA1          DAKATYELGEFFPMEAQLSRLVGQ----------------------------------------------
1bgxT2          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           KISKKEFNIASPKQLGEIIYNDLKIAVLKKTRKGSFATNASVLEDLAFKGHEFPKLILDWRQVSKLKNTY
1bgxT4          RLAGHPFNLNSRDQLERVLFDELGLPAIGKTEKGKRSTSAAVLEALREA-HPIVEKILQYRELTKLKSTY
1skrA2          PVEHVVFNPSSRDHIQKKLQEAGWVPT-KYTDKGAPVVDDEVLEGVRVDDQAAIDLIKEYLMIQKRIGQS
2hbjA2          ----------------------------------------------------------------------
1exnA2          ----------------------------------------------------------------------
1q40B           DSSHPHLIESGSTDFGYYLNNSRNLTRVSAKLSIGQEQIYKSFQQLPKTRHDIIATPELFSXEVYKFPTL
1d8yA1          ----------------------------------------------------------------------
1a76A2          ----------------------------------------------------------------------
1yt3A3          ----------------------------------------------------------------------
1tfrA2          ----------------------------------------------------------------------
1exnA1          ----------------------------------------------------------------------
1l3sA1          ----------------------------------------------------------------------
1i3qH           SFGGLLMRLEGNYRLNNLKQENAYLLIRR-----------------------------------------
1bgxT1          ----------------------------------------------------------------------
1skrA1          ----------------------------------------------------------------------
1ul1X1          ----------------------------------------------------------------------
2i5hA1          ----------------------------------------------------------------------
1dgsA1          ----------------------------------------------------------------------
1vk0A           ----------------------------------------------------------------------
1a76A1          ----------------------------------------------------------------------
2j9uB1          ----------------------------------------------------------------------
1z00B1          ----------------------------------------------------------------------
1j53A           ----------------------------------------------------------------------
2a1jA1          ----------------------------------------------------------------------
1keaA           ----------------------------------------------------------------------
2csbA4          ----------------------------------------------------------------------
1d5aA1          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           SDALPEHINPNTKRVHTSFLLAATTTGRLASSDPNLQNIPIKSEDGKDIRKAFIAEKGFTLISADYNQIE
1bgxT4          IDPLPDLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQIE
1skrA2          AEGAWLRYVAEDGKIHGSVNPNGAVTGRATHAFPNLAQIPVRSPYGEQCRAAFGAEKPWVQAGIDASGLE
2hbjA2          ----------------------------------------------------------------------
1exnA2          ----------------------------------------------------------------------
1q40B           NGI----XITLHGSFDEVAQPEVDGSASRYHSGPKHKRIP---LSKKSFDRTFVVIPGSXIVASD----T
1d8yA1          ----------------------------------------------------------------------
1a76A2          ----------------------------------------------------------------------
1yt3A3          ----------------------------------------------------------------------
1tfrA2          ----------------------------------------------------------------------
1exnA1          ----------------------------------------------------------------------
1l3sA1          ----------------------------------------------------------------------
1i3qH           ----------------------------------------------------------------------
1bgxT1          ----------------------------------------------------------------------
1skrA1          ----------------------------------------------------------------------
1ul1X1          ----------------------------------------------------------------------
2i5hA1          ----------------------------------------------------------------------
1dgsA1          ----------------------------------------------------------------------
1vk0A           ----------------------------------------------------------------------
1a76A1          ----------------------------------------------------------------------
2j9uB1          ----------------------------------------------------------------------
1z00B1          ----------------------------------------------------------------------
1j53A           ----------------------------------------------------------------------
2a1jA1          ----------------------------------------------------------------------
1keaA           ----------------------------------------------------------------------
2csbA4          ----------------------------------------------------------------------
1d5aA1          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           MRILADLAEVKELKKAFSNNEDIHSLTASQVFNVDIKKVDQDMRRKAKAINFGIIYGISQYGLAKQINVS
1bgxT4          LRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIP
1skrA2          LRCLAHFMA------RFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAG
2hbjA2          ----------------------------------------------------------------------
1exnA2          ----------------------------------------------------------------------
1q40B           LLIRPYTSDFPWK---------------------------------------------------------
1d8yA1          ----------------------------------------------------------------------
1a76A2          ----------------------------------------------------------------------
1yt3A3          ----------------------------------------------------------------------
1tfrA2          ----------------------------------------------------------------------
1exnA1          ----------------------------------------------------------------------
1l3sA1          ----------------------------------------------------------------------
1i3qH           ----------------------------------------------------------------------
1bgxT1          ----------------------------------------------------------------------
1skrA1          ----------------------------------------------------------------------
1ul1X1          ----------------------------------------------------------------------
2i5hA1          ----------------------------------------------------------------------
1dgsA1          ----------------------------------------------------------------------
1vk0A           ----------------------------------------------------------------------
1a76A1          ----------------------------------------------------------------------
2j9uB1          ----------------------------------------------------------------------
1z00B1          ----------------------------------------------------------------------
1j53A           ----------------------------------------------------------------------
2a1jA1          ----------------------------------------------------------------------
1keaA           ----------------------------------------------------------------------
2csbA4          ----------------------------------------------------------------------
1d5aA1          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           NHEADEFLNAYFLKFPEIKIYMDNTIKFCRKSGYVTNIFGRRSHFNGINDKNFNVRNFQERAAINAPIQG
1bgxT4          YEEAQAFIERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQG
1skrA2          KERGKELKKKFLENTPAIAALREQTLVEKWKRRWIKGLDGRKVHVRS------------PHAALNTLLQS
2hbjA2          ----------------------------------------------------------------------
1exnA2          ----------------------------------------------------------------------
1q40B           ----------------------------------------------------------------------
1d8yA1          ----------------------------------------------------------------------
1a76A2          ----------------------------------------------------------------------
1yt3A3          ----------------------------------------------------------------------
1tfrA2          ----------------------------------------------------------------------
1exnA1          ----------------------------------------------------------------------
1l3sA1          ----------------------------------------------------------------------
1i3qH           ----------------------------------------------------------------------
1bgxT1          ----------------------------------------------------------------------
1skrA1          ----------------------------------------------------------------------
1ul1X1          ----------------------------------------------------------------------
2i5hA1          ----------------------------------------------------------------------
1dgsA1          ----------------------------------------------------------------------
1vk0A           ----------------------------------------------------------------------
1a76A1          ----------------------------------------------------------------------
2j9uB1          ----------------------------------------------------------------------
1z00B1          ----------------------------------------------------------------------
1j53A           ----------------------------------------------------------------------
2a1jA1          ----------------------------------------------------------------------
1keaA           ----------------------------------------------------------------------
2csbA4          ----------------------------------------------------------------------
1d5aA1          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           SASEIMRLAMIRLNKKFESIKNNKSKILLQIHDELIFEVPVKEVKNITEIIKDEMTSVTESDLHTFSTPL
1bgxT4          TAADLMKLAMVKLFPR---LEEMGARMLLQVHDELVLEA----AEAVARLAKEVMEGVYP-----LAVPL
1skrA2          AGALICKLWIIKTEEMLVHGWDGDFAYMAWVHDEIQVGCRTEEIA---QVVIETAQEAMRGDHWNFRCLL
2hbjA2          ----------------------------------------------------------------------
1exnA2          ----------------------------------------------------------------------
1q40B           ----------------------------------------------------------------------
1d8yA1          ----------------------------------------------------------------------
1a76A2          ----------------------------------------------------------------------
1yt3A3          ----------------------------------------------------------------------
1tfrA2          ----------------------------------------------------------------------
1exnA1          ----------------------------------------------------------------------
1l3sA1          ----------------------------------------------------------------------
1i3qH           ----------------------------------------------------------------------
1bgxT1          ----------------------------------------------------------------------
1skrA1          ----------------------------------------------------------------------
1ul1X1          ----------------------------------------------------------------------
2i5hA1          ----------------------------------------------------------------------
1dgsA1          ----------------------------------------------------------------------
1vk0A           ----------------------------------------------------------------------
1a76A1          ----------------------------------------------------------------------
2j9uB1          ----------------------------------------------------------------------
1z00B1          ----------------------------------------------------------------------
1j53A           ----------------------------------------------------------------------
2a1jA1          ----------------------------------------------------------------------
1keaA           ----------------------------------------------------------------------
2csbA4          ----------------------------------------------------------------------
1d5aA1          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           TVDVNTGDNWGILH
1bgxT4          EVEVGIGEDWLSAK
1skrA2          DTEGKMGPNWAICH
2hbjA2          --------------
1exnA2          --------------
1q40B           --------------
1d8yA1          --------------
1a76A2          --------------
1yt3A3          --------------
1tfrA2          --------------
1exnA1          --------------
1l3sA1          --------------
1i3qH           --------------
1bgxT1          --------------
1skrA1          --------------
1ul1X1          --------------
2i5hA1          --------------
1dgsA1          --------------
1vk0A           --------------
1a76A1          --------------
2j9uB1          --------------
1z00B1          --------------
1j53A           --------------
2a1jA1          --------------
1keaA           --------------
2csbA4          --------------
1d5aA1          --------------
1bgxT2          --------------