[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for pubi0:AAZ21058.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1dtwB1.bssp"
#ERROR : Can't open dsspfile "1ni4A.bssp"
#ERROR : Can't open dsspfile "1dtwA.bssp"
#ERROR : Can't open dsspfile "1b2vA.bssp"
#ERROR : Can't open dsspfile "1o7d.3.bssp"
#ERROR : Can't open dsspfile "2d80A1.bssp"
#ERROR : Can't open dsspfile "1ay0A2.bssp"
#ERROR : Can't open dsspfile "1um9A.bssp"
#ERROR : Can't open dsspfile "1mbmA.bssp"
#ERROR : Can't open dsspfile "1b0pA2.bssp"
#ERROR : Can't open dsspfile "1upaA3.bssp"
#ERROR : Can't open dsspfile "2p8tA2.bssp"
#ERROR : Can't open dsspfile "1dtwB2.bssp"
#ERROR : Can't open dsspfile "2fpnA1.bssp"
#ERROR : Can't open dsspfile "1ovmA3.bssp"
#ERROR : Can't open dsspfile "1ozfA3.bssp"
#ERROR : Can't open dsspfile "1l8aA1.bssp"
#ERROR : Can't open dsspfile "1zpdA3.bssp"
#ERROR : Can't open dsspfile "1powA2.bssp"
#ERROR : Can't open dsspfile "1powA3.bssp"
#ERROR : Can't open dsspfile "1floA2.bssp"

## Summary of PDB Search
:967
    1e-49  23%  1dtwB1 [c.36.1.7] BRANCHED-CHAIN ALPHA-KETO ACID DEHYDROGENASE B:17
    5e-45  21%  1ni4A  [c.36.1.11] PYRUVATE DEHYDROGENASE E1 COMPONENT: ALPHA
    1e-38  13%  1dtwA  [c.36.1.11] BRANCHED-CHAIN ALPHA-KETO ACID DEHYDROGENASE
    9e-36  17%  1b2vA  [d.35.1.1] PROTEIN (HEME-BINDING PROTEIN A)
    3e-35  10%  1o7d.3 [c.6.2.1] LYSOSOMAL ALPHA-MANNOSIDASE A:51 -- 342 B:347 --
    9e-30  19%  2d80A1 [c.69.1.37] PHB DEPOLYMERASE A:21 -- 338
    2e-29  12%  1ay0A2 [c.36.1.6] TRANSKETOLASE A:338 -- 534
    1e-27  14%  1um9A  [c.36.1.11] 2-OXO ACID DEHYDROGENASE ALPHA SUBUNIT
    9e-22  13%  1mbmA  [b.47.1.3] CHYMOTRYPSIN-LIKE SERINE PROTEASE
    1e-16  11%  1b0pA2 [c.36.1.12] PROTEIN (PYRUVATE-FERREDOXIN OXIDOREDUCTASE)
    6e-14  19%  1upaA3 [c.36.1.9] CARBOXYETHYLARGININE SYNTHASE A:375 -- 572
    2e-13  11%  2p8tA2 [d.74.4.2] HYPOTHETICAL PROTEIN PH0730 A:83 -- 199
    8e-12  14%  1dtwB2 [c.48.1.2] BRANCHED-CHAIN ALPHA-KETO ACID DEHYDROGENASE
    2e-11  20%  2fpnA1 [d.129.10.1] YWMB A:1 -- 214
    1e-07  11%  1ovmA3 [c.36.1.9] INDOLE-3-PYRUVATE DECARBOXYLASE A:356 -- 551
    4e-07  15%  1ozfA3 [c.36.1.9] ACETOLACTATE SYNTHASE, CATABOLIC A:367 -- 554
    1e-06   9%  1l8aA1 [c.36.1.10] PYRUVATE DEHYDROGENASE E1 COMPONENT A:56 -- 470
    4e-06   8%  1zpdA3 [c.36.1.9] PYRUVATE DECARBOXYLASE A:363 -- 566
    5e-06  11%  1powA2 [c.36.1.5] PYRUVATE OXIDASE A:9 -- 182
    2e-04  13%  1powA3 [c.36.1.9] PYRUVATE OXIDASE A:366 -- 593
    5e-04  18%  1floA2 [d.163.1.1] FLP RECOMBINASE A:135 -- 423
:967

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dtwB1          ----------------------------------------------------------------------
1ni4A           ----------------------------------------------------------------------
1dtwA           ----------------------------------------------------------------------
1b2vA           ----------------------------------------------------------------------
1o7d.3          ----------------------------------------------------------------------
2d80A1          ----------------------------------------------------------------------
1ay0A2          ----------------------------------------------------------------------
1um9A           ----------------------------------------------------------------------
1mbmA           ----------------------------------------------------------------------
1b0pA2          ----------------------------------------------------------------------
1upaA3          ----------------------------------------------------------------------
2p8tA2          ----------------------------------------------------------------------
1dtwB2          ----------------------------------------------------------------------
2fpnA1          ----------------------------------------------------------------------
1ovmA3          ----------------------------------------------------------------------
1ozfA3          ----------------------------------------------------------------------
1l8aA1          ----------------------------------------------------------------------
1zpdA3          ----------------------------------------------------------------------
1powA2          ----------------------------------------------------------------------
1powA3          ----------------------------------------------------------------------
1floA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dtwB1          ----------------------------------------------------------------------
1ni4A           ----------------------------------------------------------------------
1dtwA           ----------------------------------------------------------------------
1b2vA           ----------------------------------------------------------------------
1o7d.3          ----------------------------------------------------------------------
2d80A1          ----------------------------------------------------------------------
1ay0A2          ----------------------------------------------------------------------
1um9A           ----------------------------------------------------------------------
1mbmA           ----------------------------------------------------------------------
1b0pA2          ----------------------------------------------------------------------
1upaA3          ----------------------------------------------------------------------
2p8tA2          ----------------------------------------------------------------------
1dtwB2          ----------------------------------------------------------------------
2fpnA1          ----------------------------------------------------------------------
1ovmA3          ----------------------------------------------------------------------
1ozfA3          ----------------------------------------------------------------------
1l8aA1          ----------------------------------------------------------------------
1zpdA3          ----------------------------------------------------------------------
1powA2          ----------------------------------------------------------------------
1powA3          ----------------------------------------------------------------------
1floA2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIGYEYMHISNPTERKWLRDRIEQDEN
1dtwB1          ----------------------------------------------------------------------
1ni4A           ------------------------------------------------FANDATFEIKKCDLHRLEEGPP
1dtwA           -----------------------------------------------SAEFIDKLEFIQPNVIQIINPSE
1b2vA           ----------------------------------------------------------------------
1o7d.3          ----------------------------------------------------------------------
2d80A1          ----------------------------------------------------------------------
1ay0A2          ----------------------------------------------------------------------
1um9A           --------------------------------------------------ETFTEEPIRLIGEEGELGDF
1mbmA           ----------------------------------------------------------------------
1b0pA2          ----------------------------------------------------------------------
1upaA3          ----------------------------------------------------------------------
2p8tA2          ----------------------------------------------------------------------
1dtwB2          ----------------------------------------------------------------------
2fpnA1          ---------------------------------------------------------YDWVIAREDKXIK
1ovmA3          ----------------------------------------------------------------------
1ozfA3          ----------------------------------------------------------------------
1l8aA1          ----------------------------------------------------------------------
1zpdA3          ----------------------------------------------------------------------
1powA2          ----------------------------------------------------------------------
1powA3          ----------------------------------------------------------------------
1floA2          --------------------------------------------SKKMLKALLSEGESIW--EITEKILN


                         .         .         .         +         .         .         .:280
query           SLQFTKNGKEAILMKLIQAEGFEKFLHKKYVGTKRFGLDGGEGLIPALEQIIKIGGQAKVKEVKIGMSHR
1dtwB1          ----------------------------------------------------------------------
1ni4A           TTVLTREDGLKYYRXXQTVRRXELKADQLYKQKIIRGFDGQEACCVGLEAGIN-------PTDHLITAYR
1dtwA           DPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSA----AALDNTDLVFGQYR
1b2vA           --------------------------------------------------------------VNYDSSFG
1o7d.3          ----------------------------------------------------------------------
2d80A1          ----------------------------------------------------------------------
1ay0A2          ----------------------------------------------------------------------
1um9A           PLDLEGEKLRRLYRDMLAARMLDERYTILIRTGKTAPAAGHEAAQVAIAHAIR------PGFDWVFPYYR
1mbmA           ----------------------------------------------------------------------
1b0pA2          ----------------------------------------------------------------------
1upaA3          ----------------------------------------------------------------------
2p8tA2          ----------------------------------------------------------------------
1dtwB2          ----------------------------------------------------------------------
2fpnA1          AIGTYTDKKNRTSFRLQLVTTLKKHNPTSYLLYEQXSLETPDSWNDTYEQFERETLGIFQEKVVIFTCLN
1ovmA3          ----------------------------------------------------------------------
1ozfA3          ----------------------------------------------------------------------
1l8aA1          ----------------------------------------------------------------------
1zpdA3          ----------------------------------------------------------------------
1powA2          ----------------------------------------------------------------------
1powA3          ----------------------------------------------------------------------
1floA2          S--FEYTSRFTKTKTLYQFLFLATFINCG-----------------------------------------


                         .         *         .         .         .         .         +:350
query           GRLNVLANVLQKSYKRIFNEFAGDIQTSGEEGAGDVKYHLGASSNREFDGNSVHVSLTDNPSHLEAVNPV
1dtwB1          ----------------------------------------------------------------------
1ni4A           AHGFTFTRGL--SVREILAELTGR-KGGCAKGKGGSXHXY--AKNFYG-----------GNGIVGAQVPL
1dtwA           EAGVLMYR--DYPLELFMAQCYGN--ISDLGKGRQMPVHYGC----------------KERHFVTISSPL
1b2vA           G--YSIHDYLGQ-WASTFGDVNHTNGNVTDANSGGFQYAISSTANQVVAGGNLTYTLFNEPAHTLY----
1o7d.3          ----------------------------------------------------------------------
2d80A1          ----------------------------------------------------------------------
1ay0A2          ----------------------------------------------------------------------
1um9A           DHGLALALGIP--LKELLGQMLATK--------ADPNKGRQMPEHPGS----KALNFFTVASPIASHVPP
1mbmA           ----------------------------------------------------------------------
1b0pA2          ----------------------------------------------------------------------
1upaA3          ----------------------------------------------------------------------
2p8tA2          ----------------------------------------------------------------------
1dtwB2          ----------------------------------------------------------------------
2fpnA1          GHLDDNXNVLQKKANQLLNEF-------------------------------------------------
1ovmA3          ----------------------------------------------------------------------
1ozfA3          ----------------------------------------------------------------------
1l8aA1          --------------------------------------------------------------GPIGAIYQ
1zpdA3          ----------------------------------------------------------------------
1powA2          ----------------------------------------------------------------------
1powA3          ----------------------------------------------------------------------
1floA2          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VLGQTRAKQFFHKDKERNKVIPILIHGDAAFAGQGVVTECFAMSGLPGHNTGGTIHIIVNNQIGFTTSPR
1dtwB1          ----------------------------------------------------------------------
1ni4A           GAGIALACKYNGKDE-----VCLTLYGDGAAN-QGQIFEAYNXAALWKLPC---IFICENNRYGXGT--S
1dtwA           QIPQAVGAAYAAKRANANRVV-ICYFGEGAAS-EGDAHAGFNFAATLECPI---IFFCRNNGYAISTPTS
1b2vA           --GQLDSLSFGDGLSGGD-------TSPYSIQVPDVSFGGLNLSSLQAQGHDGVVHQVVYGLMSGDTGAL
1o7d.3          ----------------------------------------------------------------------
2d80A1          ----------------------------------------------------------------------
1ay0A2          ----------------------------------------------------------------------
1um9A           AAGAAISMKLLRTGQ-----VAVCTFGDGATS-EGDWYAGINFAAVQGAPA---VFIAENNFP-------
1mbmA           ----------------------------------------NVGFVAGSSYGTGSVWTRNNEVVVLTASHV
1b0pA2          -LGQIAAMSDLYTKK-----SVWIFGGDGWAYDIGY----GGLDHVLASGEDVNVFVMDTEVYSATPTGA
1upaA3          --------------------PTFLIAGDGGFHSNSSDLETIARLNLP------IVTVVVNNQNIGHHRSH
2p8tA2          ----------------------------------------------------------------------
1dtwB2          ----------------------------------------------------------------------
2fpnA1          ----------------------------------------------------------------------
1ovmA3          ---------------------VIVLTGDGAAQLT-----IQELGSMLRDKQHPIILVLNNEGYTEQRYND
1ozfA3          --------------------KVVSVSGDGGF-LQS----SMELETAVRLKANVLHLIWVDNGYNMVYQRL
1l8aA1          AKFLKYLEHRGLKDTSKQTVYAFL--GDGEMD-EPESKGAITIATR--EKLDNLVFVINCNLQRLDG-PV
1zpdA3          -----------------------------LMVGDGSFQLTAEVAQMVRLKLPVIIFLINNYGYTIEVMHD
1powA2          -----------------------------GSAGPGG-THLMNGLYDAREDHVPVLALIGQFGTTGMNMDT
1powA3          ---------------------VFNLAGDGGA---SMTMQDLATQVQYHLPV---INVVFTNCQEDTNQND
1floA2          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           FARSSPYPSDVAKMVDAPILHVNGDDPEAVVYATRIATEFRLKFNRDVVVDLICYRRFGHNEGDEPSFTQ
1dtwB1          ----------------------------------------------------------------------
1ni4A           VERAAASTDYYKRGDFIPGLRVDGXDILCVREATRFAAAYCRSGKGPILXELQTYRYHGHSXSDPGVYRT
1dtwA           EQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSA--
1b2vA           ETALNGILDDYGLSVNST-----FDQVAAA----------------------------------------
1o7d.3          ----------------------------------------------------------------------
2d80A1          ----------------------------------------------------------------------
1ay0A2          ----------------------------------------------------------------------
1um9A           ------TIADKAHAFGIPGYLVDGMDVLASYYVVKEAVERARRGEGPSLVELRVYRYGPHRKKDPIPRFR
1mbmA           VGRANMATLKIGDAMLTLTFKKNGDFAEAVTTQSELPGNWPQLHFAQPTTGPASWCTATGDEEGLLSGEV
1b0pA2          VAKFAAAGKRTARMVMTGYVYVATVSMGYSKQQFLKVLKEAESFPGPSLVIAYATCINQGLRKG-MGKSQ
1upaA3          DPAVKFGGVDFVALAEANVDATRATNREELLAALRKG----AELGRPFLIEVPVNYDFQPGGFG------
2p8tA2          ----------------------------------------------------------------------
1dtwB2          ----------------------------------------------------------------------
2fpnA1          ----------------------------------------------------------------------
1ovmA3          IALWNWTHIPQALSLDPQSECWRVSEAEQLADVLEKV----AHHERLSLIEVMLPKADIP----------
1ozfA3          SGVEFGPMDFKAYAESFGAKGFAVESAEALEPTLRAA----MDVDGPAVVAIPVDYRDNP----------
1l8aA1          TGNGKIIN-ELEGIFEGVIKVMWGSRWDELLRKDTSGKLIQLDGDYQTFKSKDGAYVREHFFGKYPETAA
1zpdA3          GPYNNIKNWDYAGLMEVNGGYDSGAKAKTGGELAEAIKVALANTDGPTLIECFIGREDCTEVKWGKRVAA
1powA2          F----QEMNENPIYADVADYNVTAVNAATLPHVIDEAIRRAYAHQGVAVVQIPVDL--PWQQIPAEDW--
1powA3          FIGVEFNDIDFSKIADGVHMQAFVNKIEQLPDVFEQA--KAIAQHEPVLIDAVITGDRPLPAEKLR----
1floA2          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           PLMYKKIRSHPTPVEMYGKKLVNENTLSESELSKFKTDFKNLLDDQYKNAKDYKPKIEWYEGTWSRYKPE
1dtwB1          ----------------------------------------------------------------------
1ni4A           REEIQEVRSKSDPIXLLKDRXVNSNLASVEELKEIDVEVRKEIEDAAQFATADPEPPELGYHIYSSDPPF
1dtwA           ---------YRHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNLLFSDVYQEM-PA
1b2vA           ----------------------------------------------------------------------
1o7d.3          ----------------------------------------------------------------------
2d80A1          ----------------------------------------------------------------------
1ay0A2          ----------------------------------------------------------------------
1um9A           RFLEA------------------RGLWNEEWEEDVREEIRAELERGLKEAEAGPVPPWMFEDVFAEKPWH
1mbmA           CLAWTTSGDSGSAVVQG-----------------------------------------------------
1b0pA2          DVMNTAVKSGYWPLFRYDPRLAAQGKNPFQLDSKAPDGSVEEFLMAQNRFAVLDRSAKRLRAQVAHELDV
1upaA3          ----------------------------------------------------------------------
2p8tA2          ----------------------------------------------------------------------
1dtwB2          ----------------------------------------------------------------------
2fpnA1          ----------------------------------------------------------------------
1ovmA3          ----------------------------------------------------------------------
1ozfA3          ----------------------------------------------------------------------
1l8aA1          LVADWTDEQIWALNRGGHDPKKIYAAFKKAETKGKATVILAHTIKGYGMGDAAMDGVRHIRDRFNVITFP
1zpdA3          ANSRKPVN--------------------------------------------------------------
1powA2          ----------------------------------------------------------------------
1powA3          ----------------------------------------------------------------------
1floA2          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           KGKDKRGVSGYDQQKLLEISEKINATPEKLKLHKTIVKILDARKASVSNGKGIDWSTAEALAFGSLLEEG
1dtwB1          -------------------------------------------------TQKMNLFQSVTSALDNSLAKD
1ni4A           EVGANQWIKF------------------------------------------------------------
1dtwA           QLRKQQE----------SLARHLQTYGEHYPLDH------------------------------------
1b2vA           ----------------------------------------------------------------------
1o7d.3          ----------------------------------------------------VAWHIDPFGHSREQASLF
2d80A1          ----------------------------------------------------------------------
1ay0A2          -----------------------------------------KLPTYTAKDSAVATRKLSETVLEDVYNQL
1um9A           LLRQEALLKEE-----------------------------------------------------------
1mbmA           ----------------------------------------------------------------------
1b0pA2          EHMAATNIFESFAPAGGKADGSVDFG-EGAEFCTRDDTPMMARPDQNRAGTSEQQGDLSK----------
1upaA3          ----------------------------------------------------------------------
2p8tA2          ----------------------------------------------------------------------
1dtwB2          ----------------------------------------------------------------------
2fpnA1          ----------------------------------------------------------------------
1ovmA3          ----------------------------------------------------------------------
1ozfA3          ----------------------------------------------------------------------
1l8aA1          EGSEEH-------TYLHAQRQKLHGLPS------------------------------------------
1zpdA3          ----------------------------------------------------------------------
1powA2          ----------------------------------------------------------------------
1powA3          ----------------------------------------------------------------------
1floA2          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           YPVRLVGQDSGRGTFSQRHSVLRNQEDNSRYIPLNNISKNQMRYEIVDSFLSELAVLGFEYGYSLVEPNT
1dtwB1          PTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVF---------------NTPLCEQGIVGFGIGIAVT--GA
1ni4A           ----------------------------------------------------------------------
1dtwA           ----------------------------------------------------------------------
1b2vA           ----------------------------------------------------------------------
1o7d.3          AQMGFDGFFFGRLDYQDKKVRKKTLQMEQVWRASTSLKPPTADLFTSVLPNMYNPPEGLCWDMLCADKPV
2d80A1          ----------------------MKSWSGNQIASVANLGQRKI---YMWTGSSD----------TTVGPNV
1ay0A2          PELIGGSADLTPSNLTRWK-------EALDFQPPSSGSGNYSGRYI-RYGIREHAMGAIMNGISAFGANY
1um9A           ----------------------------------------------------------------------
1mbmA           ----------------------------------------------------------------------
1b0pA2          ----------------------------------------------------------------------
1upaA3          ----------------------------------------------------------------------
2p8tA2          ----------------------------------------------------------------------
1dtwB2          ----------------------------------------------------------------------
2fpnA1          ----------------------------------------------------------------------
1ovmA3          ----------------------------------------------------------------------
1ozfA3          ----------------------------------------------------------------------
1l8aA1          ----------------------------------------------------------------------
1zpdA3          ----------------------------------------------------------------------
1powA2          ----------------------------------------------------------------------
1powA3          ----------------------------------------------------------------------
1floA2          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           LTIWEAQFGDFANGAQVVIDQFIASGERKWTRASGLVMLLPHGYEGQGPEHSSARLERFLQLCANDNLQV
1dtwB1          TAIAEIQFADYIFPAFDQIVNEAAKYRYRSFNCGSLTIRSPWGCVGHGALYHSQSPEAFFAHCP--GIKV
1ni4A           ----------------------------------------------------------------------
1dtwA           ----------------------------------------------------------------------
1b2vA           ----------------------------------------------------------------------
1o7d.3          VEDTRSPEYNAKELVRYFLKLATD--QGKLYRTKHTVMTMGSDFQYENANTWFKNLDKLIQLVNAIRVNV
2d80A1          MNQLKAQLGNFDNSANVSYVTTT-----------GAVHTFPTDFNGAGDNSCSLSTSPYISNCNYDGAGA
1ay0A2          KPYGGT----FLNFVSYAAGA-VRLSALSGHPVIWVATHDSIGVGEDGPTHQPIETLAH--FRSLPNIQV
1um9A           ----------------------------------------------------------------------
1mbmA           ----------------------------------------------------------------------
1b0pA2          ----------------------------------------------------------------------
1upaA3          ----------------------------------------------------------------------
2p8tA2          ----------------------------------------------------SEPIGVSVDGYPG--IAI
1dtwB2          ----------------------------------------------------------------------
2fpnA1          ----------------------------------------------------------------------
1ovmA3          ----------------------------------------------------------------------
1ozfA3          ----------------------------------------------------------------------
1l8aA1          ----------------------------------------------------------------------
1zpdA3          ----------------------------------------------------------------------
1powA2          ----------------------------------------------------------------------
1powA3          ----------------------------------------------------------------------
1floA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           LNCTTPANYYHALRRQMHREFRKPLIIMTPKSLLRNKHCVSNIEDFGKDNFFHRILWDHALDEENGFIKL
1dtwB1          VIPRSPFQAKGLLLSCI--EDKNPCIFFEPKILYRAAAEEVPIE--------------------------
1ni4A           ----------------------------------------------------------------------
1dtwA           ----------------------------------------------------------------------
1b2vA           ----------------------------------------------------------------------
1o7d.3          -LYSTPACYLWELNKANLS---------------------------------------------------
2d80A1          ANTGTLSGSVLSFDTTGY--------LYVPQSCASGAGCLQSYSSIG-SRFIQNTGYN-KWADTNNMI--
1ay0A2          WRPADGNEVSAAYKNSL-ESKHTPSIIALSRQ--------------------------------------
1um9A           ----------------------------------------------------------------------
1mbmA           ----------------------------------------------------------------------
1b0pA2          ----------------------------------------------------------------------
1upaA3          ----------------------------------------------------------------------
2p8tA2          VVKNPPEFKSIELRDEAIKFDAKGAMILT----VKDNEIVFPEDFRPLKEMYPEV--AKKIVDYED----
1dtwB2          ---------------------------------------------------------------------I
2fpnA1          ----------------------------------------------------------------------
1ovmA3          ----------------------------------------------------------------------
1ozfA3          ----------------------------------------------------------------------
1l8aA1          ----------------------------------------------------------------------
1zpdA3          ----------------------------------------------------------------------
1powA2          ----------------------------------------------------------------------
1powA3          ----------------------------------------------------------------------
1floA2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           KESSKIKKVILCSGKVYFDLLEAREKLKKDDVVLYRIEQLYPFPVKSLVREIKKYAKNANFYWCQEEPKN
1dtwB1          ----------------------------------------------------------------------
1ni4A           ----------------------------------------------------------------------
1dtwA           ----------------------------------------------------------------------
1b2vA           ----------------------------------------------------------------------
1o7d.3          ----------------------------------------------------------------------
2d80A1          ----------------------------------------------------------------------
1ay0A2          ----------------------------------------------------------------------
1um9A           ----------------------------------------------------------------------
1mbmA           ----------------------------------------------------------------------
1b0pA2          ----------------------------------------------------------------------
1upaA3          ----------------------------------------------------------------------
2p8tA2          -----GDAVIITWAETPAKALKSAIHVA------------------------------------------
1dtwB2          QEGSDV--TLVAWGTQVHVIREVASMAKEKSCEVIDLRTIIPWDVDT----ICKSVIKTGRLLISHEAPL
2fpnA1          ----------------------------------------------------------------------
1ovmA3          ----------------------------------------------------------------------
1ozfA3          ----------------------------------------------------------------------
1l8aA1          ----------------------------------------------------------------------
1zpdA3          ----------------------------------------------------------------------
1powA2          ----------------------------------------------------------------------
1powA3          ----------------------------------------------------------------------
1floA2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           MGAWFSVRDYIQWTLETINANNTGISYIGRSPDASPATGYAKRHLAQQQEIIKKVFE
1dtwB1          ---------------------------------------------------------
1ni4A           ---------------------------------------------------------
1dtwA           ---------------------------------------------------------
1b2vA           ---------------------------------------------------------
1o7d.3          ---------------------------------------------------------
2d80A1          ---------------------------------------------------------
1ay0A2          ---------------------------------------------------------
1um9A           ---------------------------------------------------------
1mbmA           ---------------------------------------------------------
1b0pA2          ---------------------------------------------------------
1upaA3          ---------------------------------------------------------
2p8tA2          ---------------------------------------------------------
1dtwB2          TGGFASISSTVQE--ECFLNLEAPISRVCGYDTPFPHIFEPFYIP-DKWKCYDALRK
2fpnA1          ---------------------------------------------------------
1ovmA3          ---------------------------------------------------------
1ozfA3          ---------------------------------------------------------
1l8aA1          ---------------------------------------------------------
1zpdA3          ---------------------------------------------------------
1powA2          ---------------------------------------------------------
1powA3          ---------------------------------------------------------
1floA2          ---------------------------------------------------------