[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for pubi0:AAZ21098.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1fiqB2.bssp"
#ERROR : Can't open dsspfile "1w1oA2.bssp"
#ERROR : Can't open dsspfile "1ffuC2.bssp"
#ERROR : Can't open dsspfile "1mbbA1.bssp"
#ERROR : Can't open dsspfile "1ahuA2.bssp"
#ERROR : Can't open dsspfile "1t3qC2.bssp"
#ERROR : Can't open dsspfile "1jroA4.bssp"
#ERROR : Can't open dsspfile "1kuuA.bssp"
#ERROR : Can't open dsspfile "1f0xA2.bssp"
#ERROR : Can't open dsspfile "1i19A2.bssp"
#ERROR : Can't open dsspfile "1hskA1.bssp"
#ERROR : Can't open dsspfile "1f0xA1.bssp"

## Summary of PDB Search
:422
    1e-18   8%  1fiqB2 [d.145.1.3] XANTHINE OXIDASE B:224 -- 414
    2e-18  16%  1w1oA2 [d.145.1.1] CYTOKININ DEHYDROGENASE 1 A:40 -- 245
    1e-17  10%  1ffuC2 [d.145.1.3] CUTM, FLAVOPROTEIN OF CARBON MONOXIDE C:1 -- 177
    6e-17  16%  1mbbA1 [d.145.1.2] URIDINE DIPHOSPHO-N-ACETYLENOLPYRUVYLGLUCOSAMINE
    2e-16  16%  1ahuA2 [d.145.1.1] VANILLYL-ALCOHOL OXIDASE A:6 -- 273
    2e-15  13%  1t3qC2 [d.145.1.3] QUINOLINE 2-OXIDOREDUCTASE MEDIUM SUBUNIT C:1 --
    3e-15  10%  1jroA4 [d.145.1.3] XANTHINE DEHYDROGENASE, CHAIN A A:179 -- 345
    1e-14  11%  1kuuA  [d.153.2.1] CONSERVED PROTEIN
    8e-14  13%  1f0xA2 [d.145.1.1] D-LACTATE DEHYDROGENASE A:9 -- 273
    2e-13  16%  1i19A2 [d.145.1.1] CHOLESTEROL OXIDASE A:57 -- 273
    2e-11  17%  1hskA1 [d.145.1.2] UDP-N-ACETYLENOLPYRUVOYLGLUCOSAMINE REDUCTASE
    3e-09  12%  1f0xA1 [d.58.32.2] D-LACTATE DEHYDROGENASE A:274 -- 567
:422

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxYYPEDELQVSNLVQELYKKNQPTEIIGTGSKNFIGNNIQSAKKLSMSKLSGVIEYL
1fiqB2          --------------IQASTLKELLDLKA--QHPEAKLVVGNTEIGIEMKKNQLFPMIICPAWIPELNAVE
1w1oA2          ---------------YPSSTGDLVALLSAANSTPGTIAFRGRGHSLMGQAFAPGGVVVNMASLGDAINVS
1ffuC2          --------------HAPKSVGEAVALLGQL---GSDAKLLAGGHSLLPMMKLRFAQPIDINRIPELRGIR
1mbbA1          --------------VCAEDEQQLLNAWQYATAEGQPVLILGEGS-NVLFLEDYRGTVIINRIKGIEIHDE
1ahuA2          ---------------APRNVADVQSIVGLANKFSFPLWPISIGRNSGYGGAAPRVSGLDMGKNNRVLEVN
1t3qC2          --------------RAPASLQEVIQVLA--DDPDARIIAGGQSLLPLLARLVYPSCLVDLRNVSELFEIS
1jroA4          --------------FLPETSDALADWYL--AHPEATLIAGGTDVSLWVTALRDLPEVAFLSHCKDLAQIR
1kuuA           ---------------------------------------------------------NGSFVAYRVSSRS
1f0xA2          --------------VFPGSLLELWRVLKACVTADKIILMQAANTGLTEGSTPNGNDYISTLRLDK-LHVL
1i19A2          ---------------SPKTPQDVVRLANWAHEHDYKIRPRGAMTPLTVEKGANVEKVILADTMTHLNG--
1hskA1          ---------------TPTKNEEVQAVVKYAYQNEIPVTYLGNGSNIIIREGGIRGIVISLLSL-------
1f0xA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PEELYIKVKANTPXXXXXXXXXXXXXXXAFEPIDFGFIENGKSNKGTIAGHLACNFAGSRRFKVGSLRDH
1fiqB2          HGPEGISFGAACALSSVEK---------TLLEAVAKLPTQKTEVFRGVLEQLRWFAGKQVKITASPISDL
1w1oA2          ADGRYVDAGGEQVWIDVLR---------ASLARGVAPRSWTDYLYLTVGGTLSNAGISGQAFRHGPQISN
1ffuC2          EEGSTVVIGAMTVENDLISSPIVQARLPLLAEAAKLIADPQVRNRGTIGGDIAHGD----PGNDHPALSI
1mbbA1          PDAWYLHVGAGENWHRLVK---------YTLQEGMPGLENLALIPGCVGSSPIQNIGA----YGVELQRV
1ahuA2          VEGAYCVVEPGVTYHDLHNYLEANNLRDKLWLDVPDL--------GGGSVLGNAVERGVGYTPYGDHWMM
1t3qC2          QSAGILSVGAMVTHFRNKTDPTVAKCVPILPKVLAHVAHQAVRNRGTLGGSLAHADAGAE----MPFLMA
1jroA4          ETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFA------SEQVRQVATIGGNIANGSPIGDGPPALI
1kuuA           FPNRTTSIQEERVAVVPVEGHERDV----FRNPYIA------YNCIRIVGDTAVVSNGSHTVALGMNLRD
1f0xA2          GKGEQVLAYPGTTLYSLEKALKPLGREPHSVIGSSC-------IGASVIGGICNNSGGSLV-QRGPAYTE
1i19A2          -----ITVNTGGPVATVTAGAGASIEAIELQKHDLGWANLPAPGVLSIGGALAVNAHGAALPAVGSLSNL
1hskA1          -----DHIEVSDDAIIAGSGAAIIDVSRVARDYALTGLEFACGIPGSIGGAVYMNAGA----YGGEVKDC
1f0xA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ILGFRGVNGKGDIIKSGGTVVKNVTGYDLSKLVTGSFGTLVALTEITLKVLPKKKLSNTITIHTDDxxxx
1fiqB2          NPVFMASGTKLTIVSRGTRRTVPMDHTFFPSYRKTLLGPEEILLSIEIPYSRE-----------------
1w1oA2          VLEMDVITGHGEMV-----TCSKQLNADLFDAVLGGLGQFGVITRARIAVEP------------------
1ffuC2          AVEAHFVLEGPNGRR------TVPADGFFLGTYMTLLEENEVMVEIRVPAFA------------------
1mbbA1          CAYVDSVELATGKQVRLT--AKECRFGYRDSIFKHEYQDRFAIVAVGLRLPKEWQ---------------
1ahuA2          HSGMEVVLANGELLRTGGLKPEDQPWSKIAHDGLFSQSNMGIVTKIGIWLMPN-----------------
1t3qC2          TLGATMYIASSAG----------VRSVSATDFMKGHYFTDLELVRVEIPIPA------------------
1jroA4          AMGASLTLRRGQERR------RMPLEDFFLEYRKQDRRPGEFVESVTLP---------------------
1kuuA           AIGLSLLAMDYEKD--------ELNTPRIAAAINGSEAFIGIVTADGLMVSRVPEETPVYISTYEQ----
1f0xA2          MSLFARINEDGKL------TLVNHLGIDLGETPEQILSKL------------------------------
1i19A2          VTELTAVVWNGTTYA-----LETYQRNDPRITPLLTNLGRCFLTSVTMQAGP------------------
1hskA1          IDYALCVNEQGSLIKLT----TKELELDYRNSIIQ--KEHLVVLEAAFTLAP------------------
1f0xA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1fiqB2          ----------------------------------------------------------------------
1w1oA2          ----------------------------------------------------------------------
1ffuC2          ----------------------------------------------------------------------
1mbbA1          ----------------------------------------------------------------------
1ahuA2          ----------------------------------------------------------------------
1t3qC2          ----------------------------------------------------------------------
1jroA4          ----------------------------------------------------------------------
1kuuA           ----------------------------------------------------------------------
1f0xA2          ----------------------------------------------------------------------
1i19A2          ----------------------------------------------------------------------
1hskA1          ----------------------------------------------------------------------
1f0xA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLRVVVPPSKGPKLIQFLGNKYKYYIDWCGSLYWI
1fiqB2          ----------------------------------------------------------------------
1w1oA2          ----------------------------------------------------------------------
1ffuC2          ----------------------------------------------------------------------
1mbbA1          ----------------------------------------------------------------------
1ahuA2          ----------------------------------------------------------------------
1t3qC2          ----------------------------------------------------------------------
1jroA4          ----------------------------------------------------------------------
1kuuA           ----------------------------------------------------------------------
1f0xA2          ----------------------------------------------------------------------
1i19A2          ----------------------------------------------------------------------
1hskA1          ----------------------------------------------------------------------
1f0xA1          ------------------------------------LDIALRRNDTEWYEHLPPEIDSQLVHKLYYDYIV


                         .         .         .         .         *         .         .:420
query           EVQSKKNSKVSDIKKLTKELGGYLTIIKTSDEYDYEETIFTVDDIRLLISEKIKKSFDPKRIFNPGKMYR
1fiqB2          ----------------------------------------------------------------------
1w1oA2          ----------------------------------------------------------------------
1ffuC2          ----------------------------------------------------------------------
1mbbA1          ----------------------------------------------------------------------
1ahuA2          ----------------------------------------------------------------------
1t3qC2          ----------------------------------------------------------------------
1jroA4          ----------------------------------------------------------------------
1kuuA           ----------------------------------------------------------------------
1f0xA2          ----------------------------------------------------------------------
1i19A2          ----------------------------------------------------------------------
1hskA1          ----------------------------------------------------------------------
1f0xA1          KKGVDVHALKEQMLELLQQRGAQYPA----------EHNVGHLYKAPETLQKFYRENDPTNSMNPGIGKT


                         .         .         +         .         .         .         .:490
query           xx
1fiqB2          --
1w1oA2          --
1ffuC2          --
1mbbA1          --
1ahuA2          --
1t3qC2          --
1jroA4          --
1kuuA           --
1f0xA2          --
1i19A2          --
1hskA1          --
1f0xA1          --