[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for pubi0:AAZ21174.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1jsxA.bssp"

## Summary of PDB Search
:213
    8e-07  21%  1jsxA  [c.66.1.20] GLUCOSE-INHIBITED DIVISION PROTEIN B
:213

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNEVIRERHIVDSAQIIEFVDLNS
1jsxA           -----------------------------------------------NEMLV-RHILDSIVVAPYLQGER


                         .         .         *         .         .         .         .:140
query           NIITDXXXXXXXXXXXXXXXXKNQKNLAKVHLYEKSHHKSSFLRKVSRDLKLNTEVMQENIFEAEKLDSG
1jsxA           --FIDVGTGPGLPGIPLSIVRPE----AHFTLLDSLGKRVRFLRQVQHELKLNIEPVQEEFPSEPPFD--


                         +         .         .         .         .         *         .:210
query           TIMARAFKPLPIILDLVYKNFNSYKNLIVFMGKNGEKVLEETLMNWDFDxxxxxxxxxxxxxxxxxxxxx
1jsxA           GVISRAFASLNDMVSWCHHLPGEQGRFYALKGQMPEDEIALLPEEYQVE---------------------


                         .         .         .         +         .         .         .:280
query           xxx
1jsxA           ---