[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for pubi0:AAZ21175.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1cp2A.bssp"
#ERROR : Can't open dsspfile "1g3qA.bssp"
#ERROR : Can't open dsspfile "1a82A.bssp"
#ERROR : Can't open dsspfile "1f48A2.bssp"
#ERROR : Can't open dsspfile "1eg7A.bssp"
#ERROR : Can't open dsspfile "3bbdA1.bssp"
#ERROR : Can't open dsspfile "1f48A1.bssp"
#ERROR : Can't open dsspfile "1gg4A4.bssp"
#ERROR : Can't open dsspfile "1yr6A1.bssp"

## Summary of PDB Search
:264
    3e-44  20%  1cp2A  [c.37.1.10] NITROGENASE IRON PROTEIN
    1e-37  27%  1g3qA  [c.37.1.10] CELL DIVISION INHIBITOR
    2e-28  13%  1a82A  [c.37.1.10] DETHIOBIOTIN SYNTHETASE
    1e-22  18%  1f48A2 [c.37.1.10] ARSENITE-TRANSLOCATING ATPASE A:309 -- 586
    2e-22  14%  1eg7A  [c.37.1.10] FORMYLTETRAHYDROFOLATE SYNTHETASE
    2e-22  10%  3bbdA1 [c.116.1.6] RIBOSOME BIOGENESIS PROTEIN NEP1-LIKE A:2 -- 205
    4e-19  20%  1f48A1 [c.37.1.10] ARSENITE-TRANSLOCATING ATPASE A:1 -- 296
    5e-06  20%  1gg4A4 [c.72.2.1] UDP-N-ACETYLMURAMOYLALANYL-D-GLUTAMYL-2,6- A:99
    5e-05  27%  1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244
:264

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQIISIINQKGGVGKTTTVINLAAGLAQHEKKVLVIDLDPQGNATTGLGLSNLEGSTDTIYGVLNGTRVI
1cp2A           MRQV-AIYGKGGIGKSTTTQNLTSGLHAMGKTIMVVGCDPKADSTRLLLGG-LAQKSVLDTLREEGEDVE
1g3qA           -RIISIVSGKGGTGKTTVTANLSVALGDRGRKVLAVDGDLTMANLSLVL--GVDDPDVTLHDVLAGEANV
1a82A           -KRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSD---ALALQRNSSLQLD
1f48A2          --GLIMLMGKGGVGKTTMAAAIAVRLADMGFDVHLTTSDPAAHLN-------------NLQVSRIDPHEE
1eg7A           ILVTAITPTPAGEGKTTTSVGLTDALARLGKRVMVCLREPSLGPSFGIK-GGAAGGGYAQVVPMEDINLH
3bbdA1          ------------------------------------------------------------YNIILAKSAL
1f48A1          -----FFTGKGGVGKTSISCATAIRLAEQGKRVLLVSTDPASNVGQVFSIGNTIQAIASVPGLIDPQAAA
1gg4A4          -----VVALTGSSGKTSVKEXTAAILSQCGNTLYT-----AGNLNNDIGVTLLRLTPEYDYAVIEGANHQ
1yr6A1          --MIVVFVGTAGSGKTTLTGEFGRYLEDNYKVA-YVNLDT------------------------------


                         .         .         *         .         .         .         .:140
query           SDVIRKTEFKNLDIITSNVDLSGLEVETADDSMRAFILKRELTAYLNDSRATYDYVLIDCPPSLSLLTVM
1cp2A           LDSILKEGYGGIRCVESGGPEPGVGCAGR-GIITSINMLEQLGAYTDD----LDYVFYDVLGDVGFAMPI
1g3qA           EDAIYMTQFDNVYVLPGAVDWEHVLK------ADPRKLPEVIKSLKDK----FDFILIDCPAGLQLDAMS
1a82A           YATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQ-----------ADWVLVEGAGGWFTPLSD
1f48A2          TERYRQHVLETKGKELDEAGKRLLEEDLRSPCTEEIAVFQAFSRVIREAG--KRFVVMDTAPTGHLLLLD
1eg7A           FTGDIHAVTYAHNLLAAMVDNHLQQGNVLNIDPRTITWRRVIDLNERA----LRNIVIGLGG-----KAN
3bbdA1          ELIPEEKNKIRKSRVYKYDILDSNYHYKAXEKLKDKEXR-----GRPDIIHISLLNILDSPINHEKKLNI
1f48A1          QQYRARIVDPIKGVLPDDV-VSSINEQLSGACTTEIAAFDEFTGLLTDASTRFDHIIFDTAPTGHTIRLL
1gg4A4          GEIAWTVSLTRPEAA-------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ALVSSHSLLVPLQTEFFALEGLTQLMKTIERIKVNLNPELKIRGILLTMFDKRNKLSTQVEKEARDYFNE
1cp2A           REGKAQEIYIVASGEMMALYAANNISKGIQKYAKSGGVRLGG----IICNSRKVANEYELLDAFAKELGS
1g3qA           AMLSGEEALLVTNPEISCLTDTMKVGIVLK------KAGLAILGFVLNRYGRSDR---DIPPEAAEDVME
1a82A           TFTFADWVTQEQLPVILVVVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPA
1f48A2          ATTPMMLLQDPERTKVLLVANLQADLERIHPWGWIINNSLSIADTRSPLLRMRAQQELPQIESVKRQHAS
1eg7A           GVPRETGFDISVASEVMACLCLASDLMDLKERFSRKVVGYTYDGKPVTAGDLEAQGSMALLMKDAIKPNL
3bbdA1          YIHTYDDKVLKINPETRLPRNYFRFLGVXEKVL---------KGERNHLIKXEEKTLEDLLNE----INA
1f48A1          QLPGAWSSFIDSNPEGASCLGMAGLEKQREQYA-------------------------------------
1gg4A4          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           KVYLTVIPRNVRLSEAPSHGMPVLMYDKSCPGSKSYFNFTDEFINQExxxxxxx
1cp2A           QL-IHFVPRSPMVTKAEINKQTVIEYDPTCEQAEEYRELARKVDANE-------
1g3qA           VPLLAVIPEDPAIREGTLEGIPAVKYKPESKGAKAFVKLAEEIE----------
1a82A           PL-LGEIPWLAENPENAATGKYI-------------------------------
1f48A2          RV--ALVP---VLASEP-TGIDKL------------------------------
1eg7A           V-----------------------------------------------------
3bbdA1          K-KIAIXTKTGKLTHPKLLKEYDTFIIGGFPYGKLKINKEKVFGDIK-------
1f48A1          ------------------------------------------------------
1gg4A4          ------------------------------------------------------
1yr6A1          ------------------------------------------------------