[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for pubi0:AAZ21176.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1vk1A.bssp"
#ERROR : Can't open dsspfile "2hwjA1.bssp"
#ERROR : Can't open dsspfile "1vz0A2.bssp"
#ERROR : Can't open dsspfile "1xw3A1.bssp"
#ERROR : Can't open dsspfile "1vz0A1.bssp"
#ERROR : Can't open dsspfile "1r71A.bssp"

## Summary of PDB Search
:282
    3e-44  19%  1vk1A  [d.268.1.2] CONSERVED HYPOTHETICAL PROTEIN
    2e-33  12%  2hwjA1 [d.268.1.3] HYPOTHETICAL PROTEIN ATU1540 A:4 -- 204
    2e-21  45%  1vz0A2 [d.268.1.1] CHROMOSOME PARTITIONING PROTEIN PARB A:23 -- 115
    5e-19  20%  1xw3A1 [d.268.1.4] SULFIREDOXIN A:28 -- 137
    5e-18  47%  1vz0A1 [a.4.14.1] CHROMOSOME PARTITIONING PROTEIN PARB A:116 -- 208
    5e-09  21%  1r71A  [a.4.14.1] TRANSCRIPTIONAL REPRESSOR PROTEIN KORB
:282

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxETKVEINVNKVSISDLVRNKFQPRKTFDAESLQDLTNSIKERGIIQPIIVR
1vk1A           ------------------------IPVKKVEYVFIELDKMXPHEQLVQRELEDFIESVTGSGIFWKPMLL
2hwjA1          -----------------------EPRLSRIAIDKLRPTQIAVGF-REVELKRKEWRETRDFLGNHIVPVV
1vz0A2          --------------------------VVRLPLASIRPNPRQPRKRFAEESLKELADSIREKGLLQPLLVR
1xw3A1          -------------------HSGRIAAVHNVPLSVLIR--PLPSV-LDPAKVQSLVDTIREDPDSVPPIDV
1vz0A1          ----------------------------------------------------------------------
1r71A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RSSEDNSKYEIIAGERRWLSAQKAGLHEVPVVITNIDDLKSLEFAIIENVQRNDLNVIEEAQGYQRLIEE
1vk1A           AKIPGTDEYLIVDGHHRWAGLQKLGAKRAPSVILDYFD-EGVKVYTWYPAFXGDVNXVIERLKAEGLIPG
2hwjA1          AGPKDR--AYLIDHHHLVLALSKEGVEHVLTSEVAKFSHLGKDEFWSVXDHRNLIYPFDAQGLRRQS-GD
1vz0A2          ---PQGDGYELVAGERRYRAALMAGLQEVPAVVKDLTDREALELALVENLQR------------------
1xw3A1          LWIQGGDYFYSFGGCHRYAAYQQLQRETIPAKLVQSTLLRVYLGASTPDLQ-------------------
1vz0A1          -----------------------------------------------------DLSPVEEARGYQALLEM
1r71A           ------------------------------------------ADQVIENLQRNELTPREIADFIGRELAK


                         +         .         .         .         .         *         .:210
query           FSYDQEKVAQFIGKSRSHIANCLRLLNLPQAVLKLIQTQKLSAGHAKILVGLDNAEFVANKIIEKNLSVR
1vk1A           GLEEQXKVSKVLDEMDQAXEIELVYYGLKEDAKADMEKGEIDYVFIRXAPTKEVMELVKRGEVFSPXTTR
2hwjA1          IPKNIHDLEDDPFRS---LAGALRXYAKVIIPFSE-----------------------------------
1vz0A2          ----------------------------------------------------------------------
1xw3A1          ----------------------------------------------------------------------
1vz0A1          -GLTQEEVARRVGKARSTVANALRLLQLPPEALEALERGEITAGHARALLMLEPELWGLKEILEKGLSVR
1r71A           GK-KKGDIAKEIGKSPAFITQHVTLLDLPEKIADAFNTGRVRDVTVVNELVTAFKKRPEAWLDDDTQEIT


                         .         .         .         +         .         .         .:280
query           QSENFVKIFKTKKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1vk1A           HVLPFIPDKIDVK---------------------------------------------------------
2hwjA1          ----------------------------------------------------------------------
1vz0A2          ----------------------------------------------------------------------
1xw3A1          ----------------------------------------------------------------------
1vz0A1          QAE-------------------------------------------------------------------
1r71A           RGT-------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xx
1vk1A           --
2hwjA1          --
1vz0A2          --
1xw3A1          --
1vz0A1          --
1r71A           --