[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for pubi0:AAZ21179.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1f9dA.bssp"
#ERROR : Can't open dsspfile "1a8hA2.bssp"
#ERROR : Can't open dsspfile "1h3nA3.bssp"
#ERROR : Can't open dsspfile "1ffyA3.bssp"
#ERROR : Can't open dsspfile "1gaxA3.bssp"
#ERROR : Can't open dsspfile "1ileA3.bssp"
#ERROR : Can't open dsspfile "1rqgA2.bssp"
#ERROR : Can't open dsspfile "1h3nA2.bssp"
#ERROR : Can't open dsspfile "1f4lA2.bssp"
#ERROR : Can't open dsspfile "1n1bA2.bssp"
#ERROR : Can't open dsspfile "1j1uA.bssp"
#ERROR : Can't open dsspfile "1iq0A2.bssp"
#ERROR : Can't open dsspfile "1qmyA.bssp"
#ERROR : Can't open dsspfile "1h78A.bssp"
#ERROR : Can't open dsspfile "1irxA2.bssp"
#ERROR : Can't open dsspfile "1li5A2.bssp"
#ERROR : Can't open dsspfile "1d2rA.bssp"
#ERROR : Can't open dsspfile "1ffyA2.bssp"
#ERROR : Can't open dsspfile "2p84A1.bssp"
#ERROR : Can't open dsspfile "1jfaA.bssp"
#ERROR : Can't open dsspfile "1gaxA2.bssp"
#ERROR : Can't open dsspfile "1c4kA1.bssp"
#ERROR : Can't open dsspfile "1j5qA1.bssp"
#ERROR : Can't open dsspfile "1a1xA.bssp"
#ERROR : Can't open dsspfile "1ileA2.bssp"
#ERROR : Can't open dsspfile "1nzjA.bssp"
#ERROR : Can't open dsspfile "1bt1A.bssp"
#ERROR : Can't open dsspfile "2a4hA1.bssp"
#ERROR : Can't open dsspfile "1euqA2.bssp"
#ERROR : Can't open dsspfile "1bs2A2.bssp"
#ERROR : Can't open dsspfile "1edzA2.bssp"
#ERROR : Can't open dsspfile "1fl7B.bssp"
#ERROR : Can't open dsspfile "2a6tA1.bssp"
#ERROR : Can't open dsspfile "1g59A2.bssp"
#ERROR : Can't open dsspfile "1h3nA1.bssp"
#ERROR : Can't open dsspfile "1b25A1.bssp"
#ERROR : Can't open dsspfile "2bl7A1.bssp"
#ERROR : Can't open dsspfile "1f4lA1.bssp"
#ERROR : Can't open dsspfile "1x6mA.bssp"
#ERROR : Can't open dsspfile "1rqgA1.bssp"
#ERROR : Can't open dsspfile "1a8hA1.bssp"
#ERROR : Can't open dsspfile "1gaxA5.bssp"
#ERROR : Can't open dsspfile "1ileA1.bssp"
#ERROR : Can't open dsspfile "2retA1.bssp"
#ERROR : Can't open dsspfile "1ffyA1.bssp"
#ERROR : Can't open dsspfile "1pzdA1.bssp"
#ERROR : Can't open dsspfile "1a8hA2.bssp"
#ERROR : Can't open dsspfile "1h3nA3.bssp"
#ERROR : Can't open dsspfile "1ffyA3.bssp"
#ERROR : Can't open dsspfile "1rqgA2.bssp"
#ERROR : Can't open dsspfile "1f4lA2.bssp"
#ERROR : Can't open dsspfile "1li5A2.bssp"
#ERROR : Can't open dsspfile "1euqA2.bssp"

## Summary of PDB Search
:844
    1e-47  10%  1f9dA  [a.102.1.2] ENDO-1,4-BETA-GLUCANASE F
    6e-46  18%  1a8hA2 [c.26.1.1] METHIONYL-TRNA SYNTHETASE A:1 -- 348
    1e-44  47%  1h3nA3 [c.26.1.1] LEUCYL-TRNA SYNTHETASE A:1 -- 225 A:418 -- 686
    1e-42  21%  1ffyA3 [c.26.1.1] ISOLEUCYL-TRNA SYNTHETASE A:1 -- 200 A:395 -- 644
    8e-42  21%  1gaxA3 [c.26.1.1] VALYL-TRNA SYNTHETASE A:1 -- 189 A:343 -- 578
    3e-39  24%  1ileA3 [c.26.1.1] ISOLEUCYL-TRNA SYNTHETASE A:1 -- 197 A:387 -- 641
    2e-38  15%  1rqgA2 [c.26.1.1] METHIONYL-TRNA SYNTHETASE A:1 -- 138 A:174 -- 396
    7e-37  34%  1h3nA2 [b.51.1.1] LEUCYL-TRNA SYNTHETASE A:226 -- 417
    1e-35  21%  1f4lA2 [c.26.1.1] METHIONYL-TRNA SYNTHETASE A:4 -- 140 A:176 -- 388
    4e-35  10%  1n1bA2 [a.128.1.3] (+)-BORNYL DIPHOSPHATE SYNTHASE A:271 -- 598
    1e-34  12%  1j1uA  [c.26.1.1] TYROSYL-TRNA SYNTHETASE
    2e-32  12%  1iq0A2 [c.26.1.1] ARGINYL-TRNA SYNTHETASE A:97 -- 466
    2e-31   8%  1qmyA  [d.3.1.2] PROTEASE
    1e-30   9%  1h78A  [c.7.1.3] ANAEROBIC RIBONUCLEOTIDE-TRIPHOSPHATE REDUCTASE
    3e-30  15%  1irxA2 [c.26.1.1] LYSYL-TRNA SYNTHETASE A:3 -- 319
    3e-29  13%  1li5A2 [c.26.1.1] CYSTEINYL-TRNA SYNTHETASE A:1 -- 315
    7e-29  12%  1d2rA  [c.26.1.1] PROTEIN (TRYPTOPHANYL TRNA SYNTHETASE)
    2e-28  15%  1ffyA2 [b.51.1.1] ISOLEUCYL-TRNA SYNTHETASE A:201 -- 394
    2e-26   9%  2p84A1 [b.172.1.1] ORF041 A:3 -- 135
    8e-26  11%  1jfaA  [a.128.1.5] TRICHODIENE SYNTHASE
    5e-25  26%  1gaxA2 [b.51.1.1] VALYL-TRNA SYNTHETASE A:190 -- 342
    8e-25  11%  1c4kA1 [c.23.1.4] PROTEIN (ORNITHINE DECARBOXYLASE) A:1 -- 107
    5e-23  11%  1j5qA1 [b.121.2.3] MAJOR CAPSID PROTEIN A:25 -- 221
    3e-22  11%  1a1xA  [b.63.1.1] HMTCP-1
    5e-21  21%  1ileA2 [b.51.1.1] ISOLEUCYL-TRNA SYNTHETASE A:198 -- 386
    1e-18  24%  1nzjA  [c.26.1.1] HYPOTHETICAL PROTEIN YADB
    2e-18  11%  1bt1A  [a.86.1.2] PROTEIN (CATECHOL OXIDASE)
    5e-17   9%  2a4hA1 [c.47.1.23] SELENOPROTEIN SEP15 A:62 -- 178
    6e-17  15%  1euqA2 [c.26.1.1] GLUTAMINYL-TRNA SYNTHETASE A:8 -- 338
    5e-16  20%  1bs2A2 [c.26.1.1] PROTEIN (ARGINYL-TRNA SYNTHETASE) A:136 -- 483
    8e-14  11%  1edzA2 [c.58.1.2] 5,10-METHYLENETETRAHYDROFOLATE DEHYDROGENASE A:3
    4e-13  14%  1fl7B  [g.17.1.4] FOLLICLE STIMULATING PROTEIN BETA CHAIN
    8e-12  27%  2a6tA1 [a.242.1.1] SPAC19A8.12 A:1 -- 94
    6e-11  25%  1g59A2 [c.26.1.1] GLUTAMYL-TRNA SYNTHETASE A:1 -- 305
    4e-10  19%  1h3nA1 [a.27.1.1] LEUCYL-TRNA SYNTHETASE A:687 -- 814
    4e-10  21%  1b25A1 [a.110.1.1] PROTEIN (FORMALDEHYDE FERREDOXIN OXIDOREDUCTASE)
    1e-08  15%  2bl7A1 [a.29.8.2] ENTEROCINE A IMMUNITY PROTEIN A:3 -- 82
    4e-08   9%  1f4lA1 [a.27.1.1] METHIONYL-TRNA SYNTHETASE A:389 -- 548
    5e-08   4%  1x6mA  [b.88.1.4] GLUTATHIONE-DEPENDENT FORMALDEHYDE-ACTIVATING
    6e-08  13%  1rqgA1 [a.27.1.1] METHIONYL-TRNA SYNTHETASE A:397 -- 606
    3e-06  16%  1a8hA1 [a.27.1.1] METHIONYL-TRNA SYNTHETASE A:349 -- 500
    3e-06  18%  1gaxA5 [a.27.1.1] VALYL-TRNA SYNTHETASE A:579 -- 796
    7e-06  15%  1ileA1 [a.27.1.1] ISOLEUCYL-TRNA SYNTHETASE A:642 -- 821
    1e-04  20%  2retA1 [d.24.1.7] PSEUDOPILIN EPSI A:30 -- 110
    5e-04  22%  1ffyA1 [a.27.1.1] ISOLEUCYL-TRNA SYNTHETASE A:645 -- 917
    6e-04  10%  1pzdA1 [b.1.10.3] COATOMER GAMMA SUBUNIT A:604 -- 762
    1e-08  13%  1a8hA2 [c.26.1.1] METHIONYL-TRNA SYNTHETASE A:1 -- 348(query 421->665)
    5e-35  42%  1h3nA3 [c.26.1.1] LEUCYL-TRNA SYNTHETASE A:1 -- 225 A:418 -- 686(query 416->664)
    1e-09  25%  1ffyA3 [c.26.1.1] ISOLEUCYL-TRNA SYNTHETASE A:1 -- 200 A:395 -- 644(query 422->664)
    2e-15  17%  1rqgA2 [c.26.1.1] METHIONYL-TRNA SYNTHETASE A:1 -- 138 A:174 -- 396(query 419->666)
    4e-14  16%  1f4lA2 [c.26.1.1] METHIONYL-TRNA SYNTHETASE A:4 -- 140 A:176 -- 388(query 475->670)
    7e-09  13%  1li5A2 [c.26.1.1] CYSTEINYL-TRNA SYNTHETASE A:1 -- 315(query 422->664)
    1e-04   7%  1euqA2 [c.26.1.1] GLUTAMINYL-TRNA SYNTHETASE A:8 -- 338(query 470->702)
:844

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDRYNFKTVEEKWQKFWHKNKVFSSKLDKTKKKFYCLEMFPYPSGKIHMGHVRNYTIGDVLARYKTLQGY
1f9dA           HWILDVDNWYGFGARADGTSKPSYINTFQRGEQESTWETIPQPCW-DEHKFGGQYGFLDLFTKDTGTPAK
1a8hA2          ------------------------------EKVFYVTTPIYYVNAEPHLGHAYTTVVADFLARWHRLDGY
1h3nA3          MEKYNPHAIEAKWQRFWEEKGFMKADLPGGRGKQYVLVMFPYPSGDLHMGHLKNYTMGDVLARFRRMQGY
1ffyA3          --RGGLPNKEPQIQEKWDAEDQYALEKNKGNETFILHDGPPYANGNLHMGHALNKILKDFIVRYKTMQGF
1gaxA3          -KAYDPKSVEPKWAEKWAKNPFVA-NPKSGKPPFVIFMPPPNVTGSLHMGHALDNSLQDALIRYKRMRGF
1ileA3          --EPNFPKLEEEVLAFWKREKIFQKSVENRKGGYTVYEGPPTANGLPHVGHAQARSYKDLFPRYKTMRGY
1rqgA2          -------------------------------VRYMVTSALPYANGPIHAGHLAGAYLADIFVRYLRLKGE
1h3nA2          ----------------------------------------------------------------------
1f4lA2          -------------------------------KKILVTCALPYANGSIHLGHMLEHIQADVWVRYQRMRGH
1n1bA2          IIQATHQQELKDLSRWWSRLCFPEKLPFVRDRLVESFFWAQHGYQRKMAATIIATVIDDIYDVYGTLDEL
1j1uA           --------FEMIKRNTSEIISEEELREVLKKDEKSAYIG-FEPSGKIHLGHYLQIKKMIDLQNA------
1iq0A2          --------------------------FPRRPGVVLVEHTSVNPNKELHVGHLRNIALGDAIARILAYAGR
1qmyA           -----------------------------------------------TLYNGEKKTFYSRPNNHDNAQLF
1h78A           ----------------------------EDAEKWQIADALNY--AQSKTEKDVYDAFQAYEYEVNTLFSS
1irxA2          ----------------WADYIADKIIRERGEKEKYVVESGITPSGYVHVGNFRELFTAYIVGHALRDKGY
1li5A2          --------MLKIFNTLTRQKEEFKPI---HAGEVGMYVCGITVYDLCHIGHGRTFVAFDVVARYLRFLGY
1d2rA           ----------------------------------------IQPSGVITIGNYIGALRQFVELQH------
1ffyA2          ----------------------------------------------------------------------
2p84A1          ----------------------------------------------------------------------
1jfaA           LEITSAIAQMENWMVWVNDLMSFYKEFDDERDQISLVKN-YVVSDEISLHEALEKLTQDTLHSSKQMVAK
1gaxA2          ----------------------------------------------------------------------
1c4kA1          -------------------------------------------------SSLKIASTQEARQYFDTDRVV
1j5qA1          ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
1ileA2          ----------------------------------------------------------------------
1nzjA           ----------------------------------YIGRFAPSPSGELHFGSLIAALGSYLQAR-----AR
1bt1A           ----------------------------------------------------------------------
2a4hA1          ----------------------------------------------------------------------
1euqA2          --------------------------LASGKHTTVHTRFPPEPNGYLHIGHAKSICLNFGIAQDYKGQCN
1bs2A2          -----------------------SCKLVENKK--VIIEFSPNIAKPFHAGHLRSTIIGGFLANLYEKLGW
1edzA2          --------LRVIEDKDFLEEAIIQANGDDSVNGI--MVYFPVFG------NAQDQYLQQVVCKEKDVEGL
1fl7B           ----------------------------------------------------------------------
2a6tA1          ----------------------------------------------------------------------
1g59A2          ----------------------------------------PSPTGDPHVGTAYIALFNYAWARRN--GGR
1h3nA1          ----------------------------------------------------------------------
1b25A1          -------------RAYWVREFNGKDRKMDYPPKRWFTE--GLKSGPHKGEHLDEKKYDELLSEYYRI---
2bl7A1          ----------------------------------------------------------------------
1f4lA1          ----------------------------------------------------------------------
1x6mA           ----------------------------------------------------------------------
1rqgA1          ----------------------------------------------------------------------
1a8hA1          ----------------------------------------------------------------------
1gaxA5          ----------------------------------------------------------------------
1ileA1          ----------------------------------------------------------------------
2retA1          ----------------------------------------------------------------------
1ffyA1          ----------------------------------------------------------------------
1pzdA1          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1h3nA3          ----------------------------------------------------------------------
1ffyA3          ----------------------------------------------------------------------
1rqgA2          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------
1euqA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           NVLHPMGWDSFGMPAENAARQNNLDPKTWTESNIKTMRSQLKKLGLSIDWDKEISTCSEDYYKHQQEFFL
1f9dA           QFKYTNAPDADARAVQATY-WADQWAKEQGKSVSTSVGKATKMGDYLRYSFFDRKIGQPSQAGTGYDAAH
1a8hA2          RTFFLTGTDEHGETVYRAAQAAGEDPKAFVDRVSGRFKRAWDLLG--IAYDDFIRTTEERHKKVVQLVLK
1h3nA3          EVLHPMGWDAFGLPAENAALKFGVHPKDWTYANIRQAKESLRLMGILYDWDREVTTCEPEYYRWNQWIFL
1ffyA3          YAPYVPGWDTHGLPIEQALTKKGVDRKKFALEQIELQKKDFRRLGVRGDFNDPYITLKPEYEAAQIRIFG
1gaxA3          EAVWLPGTDHAGIATQVVVERLLLKEGKWKEESGGTILKQLKRLGASADWSREAFTMDEKRSRAVRYAFS
1ileA3          YAPRRAGWDTHGLPVELEVEKKLGLKRESVFTYEKEWEAFTERIAYWVDLEDAYATLEPTYIESIWWSLK
1rqgA2          DVVFICGTDEHGTPISFRALKEGRSPREIVDEFHEQIKITFQRAK--ISFDFFGRTELPIHYKLSQEFFL
1h3nA2          ----------------------------------------------------------------------
1f4lA2          EVNFICADDAHGTPIMLKAQQLGITPEQMIGEMSQEHQTDFAGFN--ISYDNYHSTHSEENRQLSELIYS
1n1bA2          ELFTDTRWDTESITRLPYYMQLCYWGFFCLQYLRKSVVDLVEAYFHEAKWYHSYTPSLDEYLNIAKISVA
1j1uA           ------GFDIIILLADLHAYLNQKGELDEIRKIGDYNKKVFEAMGLKAKYVYGSEFQLDKDYTLNVYRLA
1iq0A2          EVLVLNYIDDTGRQAAETLFALRHYGLTWDGLHQDPEYERLQPAIEEVLHALERGELREEVNRILLAQMA
1qmyA           RYVEEPFFDWVYSSPENLTLEAIKQLEDLTGLELHEGGPPALVIWNILLHTGIGTASRPSEADFHAGIFL
1h78A           NTPFVTITFGTGTDWTERMIQKAILKNRIKGLGRDGITPIFPKLVMFVEEGVNLYKDDPNYDIKQLAL--
1irxA2          EVRHIHMWDDYDRFRKVPVPDPWGCHESYAEHFMRKFEEEVEKLGIEVDLLYASELKRGEYSEEIRLAFE
1li5A2          KLKYVRNITDIDDKIIKRANENGESFVAMVDRMIAEMHKDFDALNILRPDMEPRAT---HHIAEIIELTE
1d2rA           ------EYNCYFCIVDQHAITVWQDPH-ELRQNIRRLAALYLAVGIDPTQ----------ATLFIQSEVP
1ffyA2          ----------------------------------------------------------------------
2p84A1          ------------IPKFREFDRERHRTDYQKGMSYAEQQDFDMGFT--IWFDHIEDLDLIEKDGTINRIVM
1jfaA           DPQVMDTIECFMHGYVTWHLCDRRYRLSEIY------------------------EKVKEEKTEDAQKFC
1gaxA2          ----------------------------------------------------------------------
1c4kA1          VDAVGSDFTDVGAVIAMDYETDVIDAADATKFGIPVFAVTKDAQAISADELKKI-FHIIDLEFDATVNAR
1j5qA1          ----------------------------------------------------------------------
1a1xA           --------EDVGAPPDHLWHQEGIYRDAVVEEETSFLRARVQQIQVPLGDAARPSHLLTS-----QLPLM
1ileA2          ----------------------------------------------------------------------
1nzjA           QGRWLVRIE-------------DIDPPREVPGAAETILRQLEHYG--LHWDGDVLWQSQ-RHDAYREALA
1bt1A           ----------------------------------------------------------------------
2a4hA1          ----------------------------------------------------------------------
1euqA2          LRFDDTNPVKEDIEYVESIKNDVEWLGFHWSGNVRYSSDYFDQLHAYAIELINKGLA---YVDELTPEQI
1bs2A2          EVIRMNYLGDWGKQFGLLAVERYGNEEALVKDPIHHLFDVYVRINKDIEEEGDSIPLEQSTNGKAREYFK
1edzA2          NHVYYQNLY-HNVRYLDKE---------------------------------------------------
1fl7B           ----------------------------------------------------------------------
2a6tA1          ----------LNLPAEEQSSVERLCFQIFYEDFIRAQNDQLPSLGLRVFSAKLFAHC-PLLWKWHEEAFD
1g59A2          FI----------------VRIEDTDRARYVPGAEERILAALKWLGLSYDEGPDVAAPTGPYRQSEQKYAE
1h3nA1          ----------------------------------------------------------------------
1b25A1          -----RGWDERGIPKKETLKELDLD---------------------------------------------
2bl7A1          ----------------------------------------------------------------------
1f4lA1          ----------------------------------------------------------------------
1x6mA           ----------------------------------------------------------------------
1rqgA1          ----------------------------------------------------------------------
1a8hA1          ----------------------------------------------------------------------
1gaxA5          ----------------------------------------------------------------------
1ileA1          ----------------------------------------------------------------------
2retA1          ----------------------------WKVAPVATTQPLLKAFDVSVAATTQ-----------------
1ffyA1          ----------------------------------------------------------------------
1pzdA1          -------------------------------------------------------------AATRQEIFQ
1a8hA2          ----------------------------------------------------------------------
1h3nA3          ----------------------------------------------------------------------
1ffyA3          ----------------------------------------------------------------------
1rqgA2          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------
1euqA2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           DLYDKGLVYRKENYVNWDPVDETVLANEQVVDGKGWRSGATVERKKLNQWFFNISKFSEDLLQGLDALEN
1f9dA           YLLSWYYAWGGGIDSTWSWIIGSSHNHFGYQNPF--------------AAWVLSTDANFKPKSSNGAS-D
1a8hA2          KVYEAGDIYYGEYEGLYCVSCERFYTEKELVEGLCPIHGRPVERRKEGNYFFRMEKYRPWLQEYIQENPI
1h3nA3          KMWEKGLAYRAKGLVNWCPKCQTVLANEQVVGRCWRHEDTPVEKRELEQWYLRITAYAERLLKDLEGLN-
1ffyA3          EMADKGLIYKGKKPVYWSPSSESSLAEAEIEYPHDWRTKKPVIFRATPQWFASISKVRQDILDAIENTNF
1gaxA3          RYYHEGLAYRAPRLVNWCPRCETTLSDLEV--ETCSRCGTPIEYAIFPQWWLRMRPLAEEVLKGLRRGDI
1ileA3          NLFDRGLLYRDHKVVPYCPRCGTPLSSHEVAYPHCWRCSTPLMYYATESWFIKNTLFKDELIRNNQEIHW
1rqgA2          KAYENGHLVKKVTKQAYCEHDKMFLPD------RFAICGRPISFRDSAHYYIKMQDFAERLKRWIEKQPW
1h3nA2          ----------------------------------------------------------------------
1f4lA2          RLKENGFIKNRTISQLYDPEKGMFLP------DRFVVSGATPVMRDSEHFFFDLPSFSEMLQAWTRSGAL
1n1bA2          SPAIISPTYFTFANASHDTAVIDSLYQY--------------------HDILCLAGIILRLPDDLGDVPK
1j1uA           LKTTLKRARRSMELIAREDENPKVA-----------------------EVIYPIMQVNDIHYLGVDVAVG
1iq0A2          TMHALNARYDLLVWESDIVRAGLLQKA-----LALLEQSPHVFRPREGKYAGALVMDASPVIPGLEDPFF
1qmyA           KGQEHAVFACVTSNGWYAIDDEDFYPWTPDPSDVLVFVPY------------------------------
1h78A           ------ECASKRMYPDIISAKNNKAITGSSVPVSPMGCRSFLSVWKDSTGNEILDGRNNLGVVTLNLPRI
1irxA2          KRDKIMEILNKYREIAKQPPLPENWWPAMVYCPEHRREAEIIEWDGGWKVKYKCPEGHEGWVDIRSGNVK
1li5A2          QLIAKGHAYVADNGDVMFDVPTDPTYGVLSRQKRNPMDFVLWKMSKEGEPSWPSPWGAGRPGWHIECSAM
1d2rA           AHAQAAWMLQCIVYIGELERMTQFKEPLMAADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRYGELFT
1ffyA2          ----------------------------------------------------------------------
2p84A1          MSTGLKDKNVKEIYESVRNLYGELYVVEWL------DGSFVLTEFYNGGYDHYIIDSSTEYEVLGNIYE-
1jfaA           KFYEQAANVGAVSPSEWAYPPVAQLAN-------------------------------------------
1gaxA2          ----------------------------------------------------------------------
1c4kA1          EIETAVNNYEDS----------------------------------------------------------
1j5qA1          ----------------------------------------------------------------------
1a1xA           WQLYPEERYMDNNSRLWQIQHHLMVRGQELL---------------------------------------
1ileA2          ----------------------------------------------------------------------
1nzjA           WLHEQGLSYY------------------------------------------------------------
1bt1A           ----------------------------------------------------------------------
2a4hA1          ----------------------------------------------------------------------
1euqA2          REYRGTLTQPGKNSPYRDRSVEENLALFEKMRAGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHH
1bs2A2          RMEDG-----------------------------------------------------------------
1edzA2          ----------------------------------------------------------------------
1fl7B           ----------------------------------------------------------------------
2a6tA1          DFLRY-----------------------------------------------------------------
1g59A2          ELLKRGWAYR------------------------------------------------------------
1h3nA1          ----------------------------------------------------------------------
1b25A1          ----------------------------------------------------------------------
2bl7A1          ----------------------------------------------------------------------
1f4lA1          ----------------------------------------------------------------------
1x6mA           ----------------------------------------------------------------------
1rqgA1          ----------------------------------------------------------------------
1a8hA1          ----------------------------------------------------------------------
1gaxA5          ----------------------------------------------------------------------
1ileA1          ----------------------------------------------------------------------
2retA1          ----------------------------------------------------------------------
1ffyA1          ----------------------------------------------------------------------
1pzdA1          EQLAAVPEFQGLGPLFKSSPEPVALTESET----------------------------------------
1a8hA2          ----------------------------------------------------------------------
1h3nA3          ----------------------------------------------------------------------
1ffyA3          ----------------------------------------------------------------------
1rqgA2          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------
1euqA2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           WPNKVKVMQKNWIGKSFGCEVEFKIESEKPIESIKCYTTRPDTLFGFSFLALSVDHPLAKYYEEDKEFQK
1f9dA           WAKSLDRQLYQWLQSAEGAIAGG-----ATNSWNGRYEAVPSTFYGMGYVENPVYADPGSNTMQVWSMQR
1a8hA2          RPEGYRNEVLAMLAEPIGDLSISRPKVPWGIPLPWDENHVTYVWFDALLNYVSALDYPEGEAYRTPHAWH
1h3nA3          WPEKVKAMQRAWIGRLRDWLISRQRYWGTPI---------------------------------------
1ffyA3          KVNWGKTRIYNM------------------VRDRGEWVISRQRVWGVPLPVFYAENGEIIMKETVNHVAD
1gaxA3          VPERWKKVNMDWLENVKDWNISRQLWWGHQIYCEDCQAVNVPRPERYLEDPTSCEACGSPRLKRDEDVFD
1ileA3          VPPHIKEGRYGE----------------------------------------------------------
1rqgA2          KPNVKNMVLSWIEEGLEERAITR--DLNWGIPVPLDEEDMKGKVLYVWFEAPIGYISITIEHFKRIGKP-
1h3nA2          --------------RSEGAEILFPVEGKE--VRIPVFTTRPDTLFGATFLVLAPEHPLTLELAAPEKREA
1f4lA2          QEQVANKMQEWFESGLQQWDISRDAPYFGF--EIPNAPGKYFYVWL------------------------
1n1bA2          TI-QCYMKETNASEEEAVEHVKFLIREAWKDMNTAIAAGYP-----------------------------
1j1uA           GMEQRKHMLARELLPKKVVCIHPVLTGLDGEGNFIAVDDSPEEIRAKIKKAYCPAGVV--------EGNP
1iq0A2          VLLRSNGTATYYAKDIAFQFWKMGILEGLRFRPYENPYYPGLRTSAPEGEAYTPKAEETINVVDVRQSHP
1qmyA           ----------------------------------------------------------------------
1h78A           ALDSYIGTQFN----EQKFVELFNERMDLCFEALMCRISSLKGVKATVAPILYQEGAFGVRLPDDDIIEL
1irxA2          LRWRVDWPMRWS----------------------------------------------------------
1li5A2          NCKQLGNHFDIHGGGSD-----------------------------------------------------
1d2rA           IPEARIPKVGARIMSLVDPTKKMSK-SDPNPKAYITLLDDAKTIEKKIKSAVTDSEGTIRYDKEAKP---
1ffyA2          --------------RSASIYVAFNVKDDKGVAKFIIWTTTPWTIPSNVAITVHPELKYGQYNVNGEALSD
2p84A1          NPELLEDDNH------------------------------------------------------------
1jfaA           ----------------------------------------------------------------------
1gaxA2          --------------------LRYEVEGGGFIE---IATVRPETVFADQAIAV---HP------EDERYRH
1c4kA1          ----------------------------------------------------------------------
1j5qA1          ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
1ileA2          --------------------------------SLLIWTTTPWTLPGNVAAAVHPEYTYAAFQVGDEALIL
1nzjA           ----------------------------------------------------------------------
1bt1A           ----------------------------------------------------------------------
2a4hA1          ----------------------------------------------------------------------
1euqA2          Q---------------------------------------------------------------------
1bs2A2          ----------------------------------------------------------------------
1edzA2          ----------------------------------------------------------------------
1fl7B           ----------------------------------------------------------------------
2a6tA1          ----------------------------------------------------------------------
1g59A2          ----------------------------------------------------------------------
1h3nA1          ----------------------------------------------------------------------
1b25A1          ----------------------------------------------------------------------
2bl7A1          ----------------------------------------------------------------------
1f4lA1          ----------------------------------------------------------------------
1x6mA           ----------------------------------------------------------------------
1rqgA1          ----------------------------------------------------------------------
1a8hA1          ----------------------------------------------------------------------
1gaxA5          ----------------------------------------------------------------------
1ileA1          ----------------------------------------------------------------------
2retA1          ----------------------------------------------------------------------
1ffyA1          ----------------------------------------------------------------------
1pzdA1          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1h3nA3          ----------------------------------------------------------------------
1ffyA3          ----------------------------------------------------------------------
1rqgA2          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------
1euqA2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           FREECSKTGTTEESIASAEKLGFKTDMIAVNPLDKNMKVPVYFANFVLMDYGLGAVFGCPAHDQRDLDFA
1f9dA           VAELYYKTGDARAKKLLDKWAKWINGEIKFNADG-TFQIPSTIDWEGQPDTW------------------
1a8hA2          LIGKDILKPHAVFWPTMLKAAGIPMYRHLNGRKMSKTLGNVVDPFALLEKYGRDALLLREIPYGQDTPVS
1h3nA3          ----------------------------------------------------------------------
1ffyA3          LFAEHGSNIWFEREAKDLLPEGFTHPG-------SPNGTFTKETDIMDVWFDSGSSHRGVLETRPELSFP
1gaxA3          TWFSSALWPLSTLGWPEETEDLKAFYPGDVLVTGY-DILFLWVSRMEVSGMGERPFKTVLLHGLVLDEKG
1ileA3          ----------------------------------------------------------------------
1rqgA2          ----------NEWKKYWLNIDGQTRVIHFIGKDNIPFHAIFWPAFLMAYYKDEEVEAEWNPANEYLTLEG
1h3nA2          YVEAAKRKTEIERQAEGREKTGVFLGAYALNPAT-GERIPIWTADYVLFGYGTGAIMAVPAHDQRDYEFA
1f4lA2          ----------------------------------------------------------------------
1n1bA2          ----------------------------------------------------------------------
1j1uA           IMEIAKYFL--------EYPLTIKRPEKFGGDLTV-NSYEELESLFKNKELHPMDLKNAVAEELIKI---
1iq0A2          QAL-------------------------------------------------------------------
1qmyA           ----------------------------------------------------------------------
1h78A           FKNGRSSVSLGYIGIHELNILVGRDIGREI-----LTKMNAHLKQWTERTGFAFSLYSTPAENLCYRFCK
1irxA2          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
1ffyA2          AVAEALDWDKASIKLEKEYTGKELEWVVAQHPFL-DRESLVINGDHVTTDAGTGCVHTAPGHGEDDYIVG
2p84A1          ----------------------------------------------------------------------
1jfaA           ----------------------------------------------------------------------
1gaxA2          LLGKRARIPLTEV------------------------WIPILADPAVEKDFGTGALKVTPAHDPLDYEIG
1c4kA1          ----------------------------------------------------------------------
1j5qA1          ---------------------FFKT---VYRRYT-NFAIESIQQTINGS-VGFGNKVSTQISRNGDLITD
1a1xA           ----------------------------------------------------------------------
1ileA2          EEGLGRKLLGEGTQVLKTFPGKALEGLPYTPPYALEKGYFVVLADYVSQEDGTGIVHQAPAFGAEDLETA
1nzjA           ----------------------------------------------------------------------
1bt1A           ----------------------------------------------------------------------
2a4hA1          -------------------------------------------QQPAAQRTYAKAILEVCTCKFRAYPQI
1euqA2          ----------------------------------------------------------------------
1bs2A2          ----------------------------------------------------------------------
1edzA2          ----------------------------------------------------------------------
1fl7B           ----------------------------------------------------------------------
2a6tA1          ----------------------------------------------------------------------
1g59A2          ----------------------------------------------------------------------
1h3nA1          ----------------------------------------------------------------------
1b25A1          ----------------------------------------------------------------------
2bl7A1          ----------------------------------------------------------------------
1f4lA1          ----------------------------------------------------------------------
1x6mA           ----------------------------------------------------------------------
1rqgA1          ----------------------------------------------------------------------
1a8hA1          ----------------------------------------------------------------------
1gaxA5          ----------------------------------------------------------------------
1ileA1          ----------------------------------------------------------------------
2retA1          ----------------------------------------------------------------------
1ffyA1          ----------------------------------------------------------------------
1pzdA1          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1h3nA3          ----------------------------------------------------------------------
1ffyA3          ----------------------------------------------------------------------
1rqgA2          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------
1euqA2          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           KKYNLKITPVVKPEKDKDFKINNEAYTGEGYLCNSDFLDGLKVPSQSIIKTIEFLEKNNLGTKKTNYRLK
1f9dA           ----------------------------------------------------------------------
1a8hA2          EE--------------------------------------------------------------------
1h3nA3          ----------------------------------------------------------------------
1ffyA3          ADMYLEGSDQYRGWFNSS----------------------------------------------------
1gaxA3          QKMSKSKGNVIDPLE-------------------------------------------------------
1ileA3          -----------------------------------------------------------------LKNLV
1rqgA2          KKFSTSRNWAIWVH--------------------------------------------------------
1h3nA2          RKFGLPIKKVIERPGEPLPEPLERAYEEPGIMVNSGPFDGTES-EEGKRKVIAWLEEKGLGKGRVTY---
1f4lA2          ----------------------------------------------------------------------
1n1bA2          ----------------------------------------------------------------------
1j1uA           ----------------------------------------------------------------------
1iq0A2          ----------------------------------------------------------------------
1qmyA           ----------------------------------------------------------------------
1h78A           LDTEKYGSVKDVTDKGWYTNSFHVSVEENITPFEKISREAPYHFIATGGHISYVELPDMKNNLKGLEAVW
1irxA2          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
1ffyA2          QQYELPVISPI----DDKGVFTE----------EGGQFEGMFY-DKANKAVTDLLTEKGALLKLDFIT--
2p84A1          ----------------------------------------------------------------------
1jfaA           ----------------------------------------------------------------------
1gaxA2          ERHGLKPVSVI----NLEGRMEGERV--------PEALRGLDR-FEARRKAVELFREAGHLVKEEDYTIA
1c4kA1          ----------------------------------------------------------------------
1j5qA1          IVVEFVL-------TKGGNGGTTYYPAEELLQDVELEIGGQRIDKHYTYDALFRMNDDRYNYRRMTDWVN
1a1xA           ----------------------------------------------------------------------
1ileA2          RVYGLPLLKT----VDEEGKL------------LVEPFKGLYF-REANRAILRDLRGRGLLFKEESYL--
1nzjA           ----------------------------------------------------------------------
1bt1A           ----------------------------------------------------------------------
2a4hA1          QAFIQSGRPAKFPNLQIKYVRGLKLLDASGKVQETLSITKWNT-DTVEEFFETHLAKDGAGKNSYSV---
1euqA2          ----------------------------------------------------------------------
1bs2A2          ----------------------------------------------------------------------
1edzA2          ----------------------------------------------------------------------
1fl7B           ---------------------------------------------------TIAIEKEECRFCISINTAW
2a6tA1          ----------------------------------------------------------------------
1g59A2          ----------------------------------------------------------------------
1h3nA1          ----------------------------------------------------------------------
1b25A1          ----------------------------------------------------------------------
2bl7A1          ----------------------------------------------------------------------
1f4lA1          ----------------------------------------------------------------------
1x6mA           ----------------------------------------------------------------------
1rqgA1          ----------------------------------------------------------------------
1a8hA1          ----------------------------------------------------------------------
1gaxA5          ----------------------------------------------------------------------
1ileA1          ----------------------------------------------------------------------
2retA1          ----------------------------------------------------------------------
1ffyA1          ----------------------------------------------------------------------
1pzdA1          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1h3nA3          -----------------------------------------------------------------IGRLR
1ffyA3          ----------------------------------------------------------------------
1rqgA2          --------------------------------------------------------------------LE
1f4lA2          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------
1euqA2          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           DWGISRQRYWGCPIPIAYDENDQPIKIPRDMLPVKLPEIEKLSNTGNPLDSEDNWKFFILDGKKYRRETD
1f9dA           ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1h3nA3          ----------------------------------------------------------------------
1ffyA3          ----------------------------------------------------------------------
1gaxA3          ----------------------------------------------------------------------
1ileA3          DWALSRNRYWGTPLPIWVCQACGKEEAIGSFQELKARATKPLPEPFDPHRYVDQVELACACGGTMRRVPY
1rqgA2          ----------------------------------------------------------------------
1h3nA2          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1n1bA2          ----------------------------------------------------------------------
1j1uA           ----------------------------------------------------------------------
1iq0A2          ----------------------------------------------------------------------
1qmyA           ----------------------------------------------------------------------
1h78A           DYAAQHLDYFGVNMPVDKCFT-------------------------------------------------
1irxA2          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
1ffyA2          ----------------------------------------------------------------------
2p84A1          ----------------------------------------------------------------------
1jfaA           ----------------------------------------------------------------------
1gaxA2          ----------------------------------------------------------------------
1c4kA1          ----------------------------------------------------------------------
1j5qA1          NELVGAQKRFYVPLIFFFNQTPGLA-LPLIALQYHEVKLYF------TLASQVQGVNYNGSSAIAGAAQP
1a1xA           ----------------------------------------------------------------------
1ileA2          ----------------------------------------------------------------------
1nzjA           ----------------------------------------------------------------------
1bt1A           ------------PIQAPEISKCVVP-------PADLPPGAVVDNCCPPVASNIVDYKLPAVTMKVRPAAH
2a4hA1          ----------------------------------------------------------------------
1euqA2          ----------------------------------------------------------------------
1bs2A2          ----------------------------------------------------------------------
1edzA2          ----------------------------------------------------------------------
1fl7B           CAGYTRDLVYKDPARPKIQKTCTFKELVYE--TVRVPGCA---HHADSLYTYPVAT----QCHCGKCDSD
2a6tA1          ----------------------------------------------------------------------
1g59A2          ----------------------------------------------------------------------
1h3nA1          ----------------------------------------------------------------------
1b25A1          ----------------------------------------------------------------------
2bl7A1          ----------------------------------------------------------------------
1f4lA1          ----------------------------------------------------------------------
1x6mA           HRCRDCGVHMYGRIENRDHPFYGLDFVHTELSDEDGWS-----APEFAAFVSSIIES----GVDPSRMEA
1rqgA1          ----------------------------------------------------------------------
1a8hA1          ----------------------------------------------------------------------
1gaxA5          ----------------------------------------------------------------------
1ileA1          ----------------------------------------------------------------------
2retA1          ----------------------------------------------------------------------
1ffyA1          ----------------------------------------------------------------------
1pzdA1          ----------------------------------------------------------------------
1a8hA2          ERRKEGNYFFRMEKYRWLQEYIQENPDLIRPEGYRNEVLAMLAEPIGDLSISRPKSRVPWGIPLPWDENH
1h3nA3          DWLISRQRYWGTPIPMVHCEACGVVPVPEEELPVLLPDLKDVEDGKSPLEAHPEFYETTCCGGPAKRDTD
1ffyA3          -WVISRQRVWGVPLPVFYAENGEIIMTKETV-----NHVADLFAEHGSNIWFEREAKDLLP-EGFTHPGS
1rqgA2          ERAITRDLNWGIPVPLDEEDMK---------------------------------------GKVLYVWFE
1f4lA2          ------------------------------------------------------YFGFEIPNAPGKYFYV
1li5A2          -DMEPRATHHIAEIIELTEQLIAKGHAYVADNGD-----VMFDVPTDPTYGVLSRQKRNPMDFVLWKMSK
1euqA2          -------------------------------------------------EGKACLRAKIDMASPFIVMRD


                         *         .         .         .         .         +         .:560
query           TLDTFVDSSWYFLRFCSPHNLDRGFTQEEANYWMPVDQYIGGVEHAILHLLYSRFFMQALSYKNDDFKLK
1f9dA           ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1h3nA3          ----------------------------------------------------------------------
1ffyA3          ----------------------------------------------------------------------
1gaxA3          ----------------------------------------------------------------------
1ileA3          VIDVWYDSGAMPFASLHYPF----EHEEVFRESFPADFIAEGIDQTRGWFNSLHQLGVMLFGS-------
1rqgA2          ----------------------------------------------------------------------
1h3nA2          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1n1bA2          ----------------------------------------------------------------------
1j1uA           ----------------------------------------------------------------------
1iq0A2          ----------------------------------------------------------------------
1qmyA           ----------------------------------------------------------------------
1h78A           ----------------------------------------------------------------------
1irxA2          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
1ffyA2          ----------------------------------------------------------------------
2p84A1          ----------------------------------------------------------------------
1jfaA           ----------------------------------------------------------------------
1gaxA2          ----------------------------------------------------------------------
1c4kA1          ----------------------------------------------------------------------
1j5qA1          TMSVWVDYI-----FLDTQE--------------------------------------------------
1a1xA           ----------------------------------------------------------------------
1ileA2          ----------------------------------------------------------------------
1nzjA           ----------------------------------------------------------------------
1bt1A           TMDKFAKAVELMKALPADQQALVHCAYCNGGYDQVNFPDQEIQVHNPFHRWYLYFYLGKLIGDPSFGLPF
2a4hA1          ----------------------------------------------------------------------
1euqA2          ----------------------------------------------------------------------
1bs2A2          ----------------------------------------------------------------------
1edzA2          ----------------------------------------------------------------------
1fl7B           STDCTVRGL--GPSYCS-----------------------------------------------------
2a6tA1          ----------------------------------------------------------------------
1g59A2          ----------------------------------------------------------------------
1h3nA1          ----------------------------------------------------------------------
1b25A1          ----------------------------------------------------------------------
2bl7A1          ----------------------------------------------------------------------
1f4lA1          ----------------------------------------------------------------------
1x6mA           IRARLRELLEPYDALSPPLMDAIATHIAKRSGALA-----------------------------------
1rqgA1          ----------------------------------------------------------------------
1a8hA1          ----------------------------------------------------------------------
1gaxA5          ----------------------------------------------------------------------
1ileA1          ----------------------------------------------------------------------
2retA1          ----------------------------------------------------------------------
1ffyA1          ----------------------------------------------------------------------
1pzdA1          ----------------------------------------------------------------------
1a8hA2          VTYVWFDALLNYVSA------LDYPEGEAYRTFWPHAWHLIGKDILKPHAVFWPTMLKAAGIPMYRH---
1h3nA3          TMDTFFDSSWYYLRYTDPHNDRLPFDPEKANAWMPVDQYIGGVEHAVLHLLYSRFFTKFLHD-LGMVKVE
1ffyA3          PNGTFTKETDIMDVWFDSGSSHRGVLETRPELSFPADMYLEGSDQYRGWFNSSITTSVATRGV-------
1rqgA2          APIGYISITIEHFKRIGKPNEW--KKYWLNIDGQTRVIHFIGKDNIPFHAIFWPAFLMAYGK----YKDE
1f4lA2          WLDAPIGYMGSFKNLCDKRGDSVSFDEYWKKDSTAELYHFIGKDIVYFHSLFWPAMLEGS--------NF
1li5A2          EGEPSWPSPWGAGRPGWHIECSAMNCK---QLGNHFDIHGGGSDLMFPHHENEIAQSTCA--------HD
1euqA2          PVLYRIKFAEHHQTGNKWCIYPMYDFTHCISDALEGITHSLCTLEFQDNRRLYDWVLDNI---------T


                         .         .         .         *         .         .         .:630
query           EPFDGLFTQGMVCHETYKDQNNKWLSPDEVTSEDGKKFYKKDNPSEKIIVGPTESMSKSKKNTIDPENII
1f9dA           ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1h3nA3          ----------------------------------------------------------------------
1ffyA3          ----------------------------------------------------------------------
1gaxA3          ----------------------------------------------------------------------
1ileA3          IAFKNVICHGLILDE------------------KGQK------------------MSKSKGNVVDPWDII
1rqgA2          ----------------------------------------------------------------------
1h3nA2          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1n1bA2          ----------------------------------------------------------------------
1j1uA           ----------------------------------------------------------------------
1iq0A2          -------------------------------------------------------VEEKNPDHPDKEEAA
1qmyA           ----------------------------------------------------------------------
1h78A           ----------------------------------------------------------------------
1irxA2          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
1ffyA2          ----------------------------------------------------------------------
2p84A1          ----------------------------------------------------------------------
1jfaA           ----------------------------------------------------------------------
1gaxA2          ----------------------------------------------------------------------
1c4kA1          ----------------------------------------------------------------------
1j5qA1          ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
1ileA2          ----------------------------------------------------------------------
1nzjA           ----------------------------------------------------------------------
1bt1A           WNWDNPGGMVLPDFLNDSTSSLYDSNRNQS------HLPPVVVDLGYNGADTDVTDQQRITDNLALMYKQ
2a4hA1          ----------------------------------------------------------------------
1euqA2          ----------------------------------------------------------------------
1bs2A2          ----------------------------------------------------------------------
1edzA2          ----------------------------------------------------------------------
1fl7B           ----------------------------------------------------------------------
2a6tA1          ----------------------------------------------------------------------
1g59A2          ----------------------------------------------------------------------
1h3nA1          ----------------------------------------------------------------------
1b25A1          ----------------------------------------------------------------------
2bl7A1          --------------------NAKQIVHELYNDISISKDPKYSDILEVXQKVY-LKLEKQKYE-LDPSPLI
1f4lA1          ----------------------------------------------------------------------
1x6mA           ----------------------------------------------------------------------
1rqgA1          ----------------------------------------------------------------------
1a8hA1          ----------------------------------------------------------------------
1gaxA5          ----------------------------------------------------------------------
1ileA1          ----------------------------------------------------------------------
2retA1          ----------------------------------------------------------------------
1ffyA1          ----------------------------------------------------------------------
1pzdA1          ----------------------------------------------------------------------
1a8hA2          ----------LNVGGFLLGPDGRK-------------------------------MSKTLGNVVDPFALL
1h3nA3          EPFQGLFTQGMVLAWTDVEVEGSVVRLPEPTRIRLMGAELRPHEDGTLHLWKPAVMSKSKGNGVMVGPFV
1ffyA3          SPYKFLLSHGFVMDGEGKK------------------------------------MSKSLGNVIVPDQVV
1rqgA2          EVEAEWNLPYDIPA-------------NEYLTLEGKK------------------FSTSRNWAIWVHEFL
1f4lA2          RKPSNLFVHGYVTVNGAK-------------------------------------MSKSRGTFIKASTWL
1li5A2          GQYVNYWMHSGMVMV------------------DREK------------------MSKSLGNFFTVRDVL
1euqA2          IPVHPRQYEFSRLNLEYTV------------------------------------MSKRKLNLLVTDKHV


                         .         +         .         .         .         .         *:700
query           KNYGADSVRLFILSDSPPEKDVQWSDQGMLASFKFVQKLWTLNSKILDKIKNNDQGSEGNDLAKFTNQLI
1f9dA           ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1h3nA3          ----------------------------------------------------------------------
1ffyA3          ----------------------------------------------------------------------
1gaxA3          ----------------------------------------------------------------------
1ileA3          RKFGADALRWYIYVSAPPEADRRFGPNLVRETVR------------------------------------
1rqgA2          ----------------------------------------------------------------------
1h3nA2          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1n1bA2          ----------------------------------------------------------------------
1j1uA           ----------------------------------------------------------------------
1iq0A2          RMVALGAIRFSMVK-TEPKKQIDFRYQEALS---------------------------------------
1qmyA           ----------------------------------------------------------------------
1h78A           ----------------------------------------------------------------------
1irxA2          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
1ffyA2          ----------------------------------------------------------------------
2p84A1          ----------------------------------------------------------------------
1jfaA           ----------------------------------------------------------------------
1gaxA2          ----------------------------------------------------------------------
1c4kA1          ----------------------------------------------------------------------
1j5qA1          ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
1ileA2          ----------------------------------------------------------------------
1nzjA           ----------------------------------------------------------------------
1bt1A           MVTNAGTAELFLGKAYRAGDAPSPGAGSIETSPHIPIHRWV-----------------------------
2a4hA1          ----------------------------------------------------------------------
1euqA2          ----------------------------------------------------------------------
1bs2A2          ----------------------------------------------------------------------
1edzA2          ----------------------------------------------------------------------
1fl7B           ----------------------------------------------------------------------
2a6tA1          ----------------------------------------------------------------------
1g59A2          ----------------------------------------------------------------------
1h3nA1          ----------------------------------FLNRIYRRVAEDREALLETSGVFQAEALEGKLHETL
1b25A1          ----------------------------------------------------------------------
2bl7A1          -----NRLVNYLYFTAYTNKRFTEYQEEL-----------------------------------------
1f4lA1          -------------------------------------LASRNAGFINKRFDGVLASELADQLYKTFTDAA
1x6mA           ----------------------------------------------------------------------
1rqgA1          -------------------------------------------------------------------KAF
1a8hA1          -------------------------------------DLGNLVQRTRAMLFRFAEGRIGEELAEGTG-LA
1gaxA5          -------------------------------------------------------------RSRL-SRGV
1ileA1          --------------------------------YSFFVTYANLDRPDLKNPPPPEKRPEMDWLLARMQDLI
2retA1          ----------------------------------------------------------------------
1ffyA1          -----------------------------------------------------------------LREFT
1pzdA1          ----------------------------------------------------------------------
1a8hA2          EKYGRDALRYYLLREIPYGQDTPVSEEALRTRYEA-----------------------------------
1h3nA3          KEQGADIARITILFAAPPENEMVWTEEGVQGAWR------------------------------------
1ffyA3          KQKGADIARLWVSS-TDYLADVRISDEILKQTSD------------------------------------
1rqgA2          DVFPADYLRYYLTTIMPETRDSDFSFSDFKVRINEE----------------------------------
1f4lA2          NHFDADSLRYYYTAKLSSRDDIDLNLEDFVQRVNA--DIV------------------------------
1li5A2          KYYDAETVRYFLMS-GHYRSQLNYSEENLKQARA------------------------------------
1euqA2          EGWDDPRMPTISGLRRRG-----YTAASIREFCKRIGVTK---QDNTIEMAS---------LESCIREDL


                         .         .         .         .         +         .         .:770
query           NKITQNLEKFHYNVIVANFYEMYNFLXXXXXXXXXXXXXXXNYKKILIVMNPFIPHFSNECLSTINENQI
1f9dA           ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1h3nA3          ----------------------------------------------------------------------
1ffyA3          ----------------------------------------------------------------------
1gaxA3          ----------------------------------------------------------------------
1ileA3          ----------------------------------------------------------------------
1rqgA2          ----------------------------------------------------------------------
1h3nA2          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1n1bA2          ----------------------------------------------------------------------
1j1uA           ----------------------------------------------------------------------
1iq0A2          ----------------------------------------------------------------------
1qmyA           ----------------------------------------------------------------------
1h78A           ----------------------------------------------------------------------
1irxA2          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
1ffyA2          ----------------------------------------------------------------------
2p84A1          ----------------------------------------------------------------------
1jfaA           ----------------------------------------------------------------------
1gaxA2          ----------------------------------------------------------------------
1c4kA1          ----------------------------------------------------------------------
1j5qA1          ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
1ileA2          ----------------------------------------------------------------------
1nzjA           ----------------------------------------------------------------------
1bt1A           ----------------------------------------------------------------------
2a4hA1          ----------------------------------------------------------------------
1euqA2          ----------------------------------------------------------------------
1bs2A2          ----------------------------------------------------------------------
1edzA2          ----------------------------------------------------------------------
1fl7B           ----------------------------------------------------------------------
2a6tA1          ----------------------------------------------------------------------
1g59A2          ----------------------------------------------------------------------
1h3nA1          KKVTEDLEALRFNTAIAALMEFLNALYEYRKDRPVTPVYRTAIRYYLQMLFPFAPHLAEELWHWFWPDSL
1b25A1          ----------------------------------------------------------------------
2bl7A1          ----------------------------------------------------------------------
1f4lA1          EVIGEAWESREFGKAVREIMALADLANRYVDEQAPWVVAKQEGRDLMTYLKPVLPKLTERAEAFLNTEGI
1x6mA           ----------------------------------------------------------------------
1rqgA1          KEVGELIMNYRFKDALKRVMSLASFGNRYFDHKQPWKTAKEDVKALGILLEPFLPDASEKIWHLLNLEFR
1a8hA1          GRLRPLVRELKFHVALEEAMAYVKALNRYINEKKPWELFKKELRIASILLTPAMPDKMAELRRALGEEAE
1gaxA5          EEITALYEALDLAQAAR---EVYELVWSEFCDWYLEAAKPALKAGLLKLLHPMMPFLTSELYQALTGKEE
1ileA1          QRVTEALEAYDPTTSAR---ALRDFVVEDLSQWYVRRNRRRFWKNVATLAAPFTPFLAEVLWQNLVRSVR
2retA1          ----------------------------------------------------------------------
1ffyA1          ASTINNYENFDYLNIYQ---EVQNFINVELSNFYLDYGKDILYVDMTKLLAPILVHTAEEHTPHVKEESV
1pzdA1          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1h3nA3          ----------------------------------------------------------------------
1ffyA3          ----------------------------------------------------------------------
1rqgA2          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------
1euqA2          NE--------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           SWPEISKEDLIEEDINFVVQINGKKRAILKIKRDVVEKEILEIIKTNLEIEKFLKDKTIKKSIxxxxxxx
1f9dA           ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1h3nA3          ----------------------------------------------------------------------
1ffyA3          ----------------------------------------------------------------------
1gaxA3          ----------------------------------------------------------------------
1ileA3          ----------------------------------------------------------------------
1rqgA2          ----------------------------------------------------------------------
1h3nA2          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1n1bA2          ----------------------------------------------------------------------
1j1uA           ----------------------------------------------------------------------
1iq0A2          ----------------------------------------------------------------------
1qmyA           ----------------------------------------------------------------------
1h78A           ----------------------------------------------------------------------
1irxA2          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
1ffyA2          ----------------------------------------------------------------------
2p84A1          ----------------------------------------------------------------------
1jfaA           ----------------------------------------------------------------------
1gaxA2          ----------------------------------------------------------------------
1c4kA1          ----------------------------------------------------------------------
1j5qA1          ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
1ileA2          ----------------------------------------------------------------------
1nzjA           ----------------------------------------------------------------------
1bt1A           ----------------------------------------------------------------------
2a4hA1          ----------------------------------------------------------------------
1euqA2          ----------------------------------------------------------------------
1bs2A2          ----------------------------------------------------------------------
1edzA2          ----------------------------------------------------------------------
1fl7B           ----------------------------------------------------------------------
2a6tA1          ----------------------------------------------------------------------
1g59A2          ----------------------------------------------------------------------
1h3nA1          GWPEL-DEKALEK---------------------------------------------------------
1b25A1          ----------------------------------------------------------------------
2bl7A1          ----------------------------------------------------------------------
1f4lA1          QQPLL-GHKVNPFKALYNRIDMRQVEALVEASKE------------------------------------
1x6mA           ----------------------------------------------------------------------
1rqgA1          ELPAGHKVRTDDQIIYFILNYMAKEGARILLDKYYKREDVIRVAKEKFGDEAEVVLRRVYKDI-------
1a8hA1          RWGLAEPRPIPEE---------------------------------------------------------
1gaxA5          AWPEPGGRDEAERAFEALKQAVTAVRALPAQEVRVYLEGETAPVEENLEVFRFL----------------
1ileA1          LWPEADPALALVAQMRAVLKVVDLARAARAKSG-------------------------------------
2retA1          ----------------------------------------------------------------------
1ffyA1          DMPKVVEVD--QALLD-------KWRTFMNLRDDV-----------NRALETARNEKVIGKS--------
1pzdA1          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1h3nA3          ----------------------------------------------------------------------
1ffyA3          ----------------------------------------------------------------------
1rqgA2          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------
1euqA2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxx
1f9dA           ----
1a8hA2          ----
1h3nA3          ----
1ffyA3          ----
1gaxA3          ----
1ileA3          ----
1rqgA2          ----
1h3nA2          ----
1f4lA2          ----
1n1bA2          ----
1j1uA           ----
1iq0A2          ----
1qmyA           ----
1h78A           ----
1irxA2          ----
1li5A2          ----
1d2rA           ----
1ffyA2          ----
2p84A1          ----
1jfaA           ----
1gaxA2          ----
1c4kA1          ----
1j5qA1          ----
1a1xA           ----
1ileA2          ----
1nzjA           ----
1bt1A           ----
2a4hA1          ----
1euqA2          ----
1bs2A2          ----
1edzA2          ----
1fl7B           ----
2a6tA1          ----
1g59A2          ----
1h3nA1          ----
1b25A1          ----
2bl7A1          ----
1f4lA1          ----
1x6mA           ----
1rqgA1          ----
1a8hA1          ----
1gaxA5          ----
1ileA1          ----
2retA1          ----
1ffyA1          ----
1pzdA1          ----
1a8hA2          ----
1h3nA3          ----
1ffyA3          ----
1rqgA2          ----
1f4lA2          ----
1li5A2          ----
1euqA2          ----