[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for pubi0:AAZ21236.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1aosA.bssp"
#ERROR : Can't open dsspfile "1c3cA.bssp"
#ERROR : Can't open dsspfile "1fuoA.bssp"
#ERROR : Can't open dsspfile "1dofA.bssp"
#ERROR : Can't open dsspfile "1q5nA.bssp"
#ERROR : Can't open dsspfile "1sziA.bssp"
#ERROR : Can't open dsspfile "1or4A.bssp"

## Summary of PDB Search
:462
    8e-83  34%  1aosA  [a.127.1.1] ARGININOSUCCINATE LYASE
    4e-82  16%  1c3cA  [a.127.1.1] PROTEIN (ADENYLOSUCCINATE LYASE)
    1e-77  18%  1fuoA  [a.127.1.1] FUMARASE C[MASQUE : MEMB(X) 0 / COIL(x) 33]
    9e-74  14%  1dofA  [a.127.1.1] ADENYLOSUCCINATE LYASE
    1e-73  14%  1q5nA  [a.127.1.1] 3-CARBOXY-CIS,CIS-MUCONATE CYCLOISOMERASE
    3e-29  12%  1sziA  [a.24.23.1] MANNOSE-6-PHOSPHATE RECEPTOR BINDING PROTEIN
    8e-27  10%  1or4A  [a.1.1.2] HEME-BASED AEROTACTIC TRANSDUCER HEMAT
:462

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxSIDIDKKLFQEDILGSIAHVEMLFRQXXXXXXXXXXXXXGLN
1aosA           ----------------------------SIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLD
1c3cA           ----------------------------DLWTEEAKYRRWLEVELAVTRAYEELGMIPKGVTERIRNNAK
1fuoA           ----------------------------------------------------------------------
1dofA           ----------------------------RLFTNEAIINAYLEVERALVCALEE---------------LG
1q5nA           ----------------------------EIFSDRALVSYMVEAEVALAQAQAQVGVIPQSAATVIQRAAK
1sziA           ----------------------------------------------------------------------
1or4A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KIEKEILKNKFEYNKKYEDIHMNIEKRLFQIIGEEAGYVHTARSRNDQVITDFKMWTTSATKEINKNLDN
1aosA           KVKLNS---------NDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWE
1c3cA           IDVELF----KKIEEKTNHDVVAFVEGIGSMIGEDSRFFHYGLTSSDVLDTANSLALVEAGKILLESLKE
1fuoA           -PLAIWQTGSGTQS--NMNMNEVLANRASELLGGVNDDVNKSQSSNDVFPTAMHVAALLALRKQLPQLKT
1dofA           VAERGCCEKVNKASVSADEVHDILSLVLLLEQKSGCRYVHYGATSNDIIDTAWALLIRRALAAVKEKARA
1q5nA           TAIDKIDFDALTATGLAGNIAIPFVKQLTAIVEDAARYVHWGATSQDILDTACILQCRDALAIVQNQVQQ
1sziA           ----------------------------------------------------------------------
1or4A           -----------------SNGQQKNRIQLTNKHADVKKQLKMVRLGDAELYVLEQLQ-----PLIQENIVN


                         +         .         .         .         .         *         .:210
query           IIKTILKISEKNIETIMPGFTHLKNAQAVSFAHYLMSYVEMFNRDKKRFTYNLESLSENPLGVAALTGTS
1aosA           LIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNP
1c3cA           FCDVLWEVANRYKHTPTIGRTHGVHAEPTSFGLKVLGWYSEMKRNVQRLERAIEEVSYGKIS--GAVGNY
1fuoA           LTQTLNEKSRAFADIVKIGRTHLQDATPLTLGQEISGWVAMLEHNLKHIEYSLPHVAELALGGTAVTGNT
1dofA           VGDQLASMARKYKTLEMVGRTHGQWAEPITLGFKFANYYYELYIACRQLALAEEFIRAKIGGTMASWGEL
1q5nA           CYETALSQAQTYRHQVMMGRTWLQQALPITLGHKLARWASAFKRDLDRINAIKARVLVAQLGGAVGSLAS
1sziA           ----------------------------------------------------------------------
1or4A           IVDAFYKDHESSLMDIINDHSSVDRLKQTLKRHIQEMFAGVIDDEFIEK---RNRIASLPKWYMGAFQEL


                         .         .         .         +         .         .         .:280
query           FNIDRNFTSKKLGFKRPTNNSIDTVADRDFVLDFLYSASVCSMHISRIAEELIIWNSDGFNLITLSDKVV
1aosA           LGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWRSLCMTHLSRMAEDLILYCTKEFSFVQLSDAYS
1c3cA           ANVPPEVEEKALSYLGLKPEPVSTVVPRDRHAFYLSTLAIVAAGIERIAVEIRHLQRTEVLEVEEPF---
1fuoA           HPEYARRVADELAVIVTAPNKFEALATCDALVQAHGALKGLAASLMKIANDVRWLASGPRCGIGEIPENE
1dofA           GLEVRRRVAERLGL--PHHVITTQVAPRESFAVLASALALMAAVFERLAVEIRELSRPE-----------
1q5nA           LQDQGSIVVEAYAKQKLGQTACTWHGERDRIVEIASVLGIITGNVGKMARDWSLMMQTEIAEVFEPTRVA
1sziA           ----------------------------------------------------------------------
1or4A           LLSMISITNQQELLKAIKATTKILNLEQQLVLE-------------------------------------


                         .         *         .         .         .         .         +:350
query           TGSSIMPQKKNPDLLEYLRGKTGTVYGNLFSMLTILKGLPISYFKDLQDDKEILFKSNEILNNSIAILNE
1aosA           TGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATG
1c3cA           -RKSAMPHKKNPITCERLTGLSRMMRAYV---DPSLENIALWHERDISHSSVVFPDATQTLYYMIVTATN
1fuoA           PGSSIMPGKVNPTQCEALTMLCCQVMGNDVAINMGGASGNFELNVFRPMVIHNFLQSVRLLADGMSFNKH
1dofA           -IGEVVEGGANPTASERIVSLARYVRALTHVAFENVALWHERDLTNSANERVWIPEALLALDEILTSALR
1q5nA           AASVLAAANRVPAL-----------------MSSIYQSMVQEHERSLGAEWLSLPEIFQLTAGALERTLD
1sziA           ------PEQVEARALSMFRDITQQLQSMCVALGASIQGLPSHVREQAQQARSQVNATFSGIHSFQDLSAG
1or4A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VLKNLKPNKQQMLDLANSGYITATDLADYLVKNHSMPFRKAYQTTASIVNYAXXXXXXXXXXXXXXXXXI
1aosA           VISTLQIHQENMGQALS-PDMLATDLAYYLVR-KGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTI
1c3cA           VVRNMKVNEERMKKNIDLGLVFSQRVLLKLIE-KGLTRKEAYDIVQRNALKT------------------
1fuoA           CAVGIEPNRERINQLLNESLMLVTALNTHIGY--------------------------------------
1dofA           VLKNVYIDEERITENLQKPYILTEFHMNRMIK-EGASRAEAYKKAKEVKALT------------------
1q5nA           VLKGMEVNAENMHQNIECTHGLIMAEAVMMALAPHMGRLNAHHVVEAACKTAVAEQKHLKDIISQVDEVK
1sziA           VLAQTRERIARARE-------ALDNTVEYVAQNTPAMWL-------------------------------
1or4A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           EPRLTIEVLKIFNVKNSVNSKKSYGGTSFDNIKKMIMKYKKx
1aosA           SPLFSGDVICVWDYRHSVEQYGALGGTARSSVDWQIRQVRA-
1c3cA           ------------------------------------------
1fuoA           ------------------------------------------
1dofA           ------------------------------------------
1q5nA           QYFNPSQLDEIFKPESYL-------GNIQDQIDAVL------
1sziA           ------------------------------------------
1or4A           ------------------------------------------