[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for pubi0:AAZ21331.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1vddA.bssp"
#ERROR : Can't open dsspfile "1nuiA1.bssp"
#ERROR : Can't open dsspfile "1gkuB3.bssp"
#ERROR : Can't open dsspfile "1gm5A2.bssp"
#ERROR : Can't open dsspfile "2fcjA1.bssp"
#ERROR : Can't open dsspfile "1cy0A.bssp"
#ERROR : Can't open dsspfile "1ryqA.bssp"

## Summary of PDB Search
:203
    1e-24  35%  1vddA  [e.49.1.1] RECOMBINATION PROTEIN RECR
    9e-16  13%  1nuiA1 [e.13.1.2] DNA PRIMASE/HELICASE A:64 -- 255
    7e-15  13%  1gkuB3 [e.10.1.1] REVERSE GYRASE B:499 -- 1054
    3e-13  12%  1gm5A2 [b.40.4.9] RECG A:106 -- 285
    1e-10  14%  2fcjA1 [c.136.1.1] SMALL TOPRIM DOMAIN PROTEIN A:1 -- 114
    4e-09  20%  1cy0A  [e.10.1.1] DNA TOPOISOMERASE I
    4e-07  18%  1ryqA  [g.41.9.3] DNA-DIRECTED RNA POLYMERASE, SUBUNIT E''
:203

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxPGLGPKSAKRIVLKLINNRDELVKPMANTLAQVYKNVIRCQSCGTLKSNSLGC
1vddA           -----------------PGIGPKSAQRLAFHLFEQPREDIERLASALLEAKRDLHVCPICFNITDAE-KC
1nuiA1          ------------------GISKETCQKAGYWIAK-VDGVMYQVADYRDQNGNIVSQKNFKTTGSHKSD-A
1gkuB3          ----------------------FDLIKPALFIVESPT------------KARQISRFFGKPSVKVLD-GA
1gm5A2          -----------------KGVGPNRKKKLKKLGIETLRDLLEFFPRDYEDRRKIFKLNDLLP-GEKVTTQG
2fcjA1          ----------------------------------------------------------------------
1cy0A           ----------------------------------------------------------------------
1ryqA           --------------------------------------------------------CRHCHYITSED-RC


                         .         .         *         .         .         .         .:140
query           NNCENSKEKYNKICVVEDIADQWSIENSNIYKGYFHILGGTISSAGQRKEDLLINSLVERVSRENIEEVI
1vddA           DVCADPSRDQRTICVVEEPGDVIALERSGEYRGLYHVLHGVLSPMGVGPDKLHIKPLLPRVGQ--GMEVI
1nuiA1          LFGKHLWNGGKKIVVTEGEIDMLTVMELQDCKYPVVSLGHGAS-------AAKKTCAANYEYFDQFEQII
1gkuB3          VVYEIPMQK-YVLMVTASIGHVVDLITNRGFHGVLVNGRFVPVYASIKDNSRSRIEALRKLAHD-AEFVI
1gm5A2          KIVSVETKKFQNHVPLKWFNQDYLQTYLKQLTGKEVFVTGTVKSNAYTGQ-YEIHNAEVTPKEGEYVRRI
2fcjA1          --------RVEKVIIVEGRSDKQKVAAVLN--EPVVIVCTNGTISDARLEEL--------ADELEGYDVY
1cy0A           ----------KALVIVESPAKAKTINKGSDYVVKSHIRMGVDPWHNWEAHYEVLPGKEKVVSEEKADHIY
1ryqA           PVCGSRDEEWFDLVIIVDVENSEIAKKIGAKVGKYAI---------------------------------


                         +         .         .         .         .         *         .:210
query           LATSATVEGQTTAYYIEDXXXXXXXXXXXXAQGLPVGGEIESLDDGTLYSAFKNRTGIKTNxx
1vddA           LATGTTVEGDATALYLQRLLEPLGAAISRIAYGVPVGGSLEYTDEVTLGRALTGR--------
1nuiA1          LMFDMDEAGRKAVEEAAQVLPAGKVRVAVLPCKDAN----ECHLNGHDREIMEQ---------
1gkuB3          VGTDPDTEGEKIAWDLKNLLSGCGAVKRA---------EFHEVTRRAILEALESLRDVDEN--
1gm5A2          LPIYRLTSGISQKQMRK----------------------------------------------
2fcjA1          LLADADEAGEKLRRQFRRMFPEAEHLYI-----DRAYREVAAAPIWHLAQVLLRA--------
1cy0A           LATDLDREGEAIAWHLRERVVFNEITKNAIRQAFNKPGEL----NIDRVNAQQAR--------
1ryqA           ---------------------------------------------------------------