[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for pubi0:AAZ21392.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1bsvA.bssp"
#ERROR : Can't open dsspfile "1vl0A.bssp"
#ERROR : Can't open dsspfile "1sb8A.bssp"
#ERROR : Can't open dsspfile "1bxkA.bssp"
#ERROR : Can't open dsspfile "2b69A1.bssp"
#ERROR : Can't open dsspfile "1kbzA.bssp"
#ERROR : Can't open dsspfile "1orrA.bssp"
#ERROR : Can't open dsspfile "1k6iA.bssp"
#ERROR : Can't open dsspfile "1db3A.bssp"
#ERROR : Can't open dsspfile "1a2zA.bssp"
#ERROR : Can't open dsspfile "1ujmA.bssp"
#ERROR : Can't open dsspfile "1qycA.bssp"
#ERROR : Can't open dsspfile "2a35A1.bssp"
#ERROR : Can't open dsspfile "1aorA1.bssp"
#ERROR : Can't open dsspfile "1u9jA.bssp"
#ERROR : Can't open dsspfile "1hdoA.bssp"
#ERROR : Can't open dsspfile "1eq2A.bssp"
#ERROR : Can't open dsspfile "1i24A.bssp"
#ERROR : Can't open dsspfile "1pfsA.bssp"
#ERROR : Can't open dsspfile "2bkaA1.bssp"
#ERROR : Can't open dsspfile "1xq6A.bssp"
#ERROR : Can't open dsspfile "1c3vA1.bssp"
#ERROR : Can't open dsspfile "1vm6A3.bssp"
#ERROR : Can't open dsspfile "2hjsA1.bssp"

## Summary of PDB Search
:312
    3e-30  43%  1bsvA  [c.2.1.2] PROTEIN (GDP-FUCOSE SYNTHETASE)
    2e-28  22%  1vl0A  [c.2.1.2] DTDP-4-DEHYDRORHAMNOSE REDUCTASE, RFBD ORTHOLOG
    2e-27  16%  1sb8A  [c.2.1.2] WBPP
    9e-26  17%  1bxkA  [c.2.1.2] PROTEIN (DTDP-GLUCOSE 4,6-DEHYDRATASE)
    4e-24  16%  2b69A1 [c.2.1.2] UDP-GLUCURONATE DECARBOXYLASE 1 A:4 -- 315
    2e-20  13%  1kbzA  [c.2.1.2] DTDP-GLUCOSE OXIDOREDUCTASE
    5e-18  16%  1orrA  [c.2.1.2] CDP-TYVELOSE-2-EPIMERASE
    5e-18   7%  1k6iA  [c.2.1.2] NMRA
    2e-17  19%  1db3A  [c.2.1.2] GDP-MANNOSE 4,6-DEHYDRATASE
    2e-13   7%  1a2zA  [c.56.4.1] PYRROLIDONE CARBOXYL PEPTIDASE
    2e-13  14%  1ujmA  [c.2.1.2] ALDEHYDE REDUCTASE II
    2e-12  13%  1qycA  [c.2.1.2] PHENYLCOUMARAN BENZYLIC ETHER REDUCTASE PT1
    1e-10  14%  2a35A1 [c.2.1.2] HYPOTHETICAL PROTEIN PA4017 A:4 -- 215
    1e-10   9%  1aorA1 [a.110.1.1] ALDEHYDE FERREDOXIN OXIDOREDUCTASE A:211 -- 605
    6e-10  13%  1u9jA  [c.2.1.2] HYPOTHETICAL PROTEIN YFBG
    1e-09  12%  1hdoA  [c.2.1.2] BILIVERDIN IX BETA REDUCTASE
    2e-09  16%  1eq2A  [c.2.1.2] ADP-L-GLYCERO-D-MANNOHEPTOSE 6-EPIMERASE
    1e-08  10%  1i24A  [c.2.1.2] SULFOLIPID BIOSYNTHESIS PROTEIN SQD1
    1e-07  10%  1pfsA  [b.40.4.7] PF3 SINGLE-STRANDED DNA BINDING PROTEIN
    4e-07   9%  2bkaA1 [c.2.1.2] TAT-INTERACTING PROTEIN TIP30 A:5 -- 236
    9e-05  22%  1xq6A  [c.2.1.2] UNKNOWN PROTEIN
    4e-04  32%  1c3vA1 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:501 -- 605 A:715
    5e-04  28%  1vm6A3 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:1 -- 96 A:183 --
    7e-04  21%  2hjsA1 [c.2.1.3] USG-1 PROTEIN HOMOLOG A:3 -- 129 A:320 -- 336
:312

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MINRNSRIFITGHKGLVGSAIYRKLKAKGYTNLLIADRKKLDLTNQXXXXXXXXXXXXXXXXXAAAKVGG
1bsvA           ------RVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGG
1vl0A           ----HXKILITGANGQLGREIQKQLKGKNV-EVIPTDVQDLDITNVLAVNKFFNEKKPNVVINCAAHTAV
1sb8A           LPAQPKVWLITGVAGFIGSNLLETLLKLDQKNFATGHQRNLDEVRSLVSEKQWSNFKFIQGDIRQAALGS
1bxkA           ------KILITGGAGFIGSALVRYIINETSDAVVVVDKEKVDICDR-AELARVFTEHQPDCVMHLAAESH
2b69A1          ------RILITGGAGFVGSHLTDKLXXDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEV
1kbzA           ------NILLFGKTGQVGWELQRSLAPVGNLIALDVHSKEFCGDFSNPKGVAETVRKLRPDVIVNAAAHT
1orrA           -----AKLLITGGCGFLGSNLASFALSQGIDLIVFDNLSRKDIRNKNDVTRLITKYMPDSCFHLAGQVAM
1k6iA           ----KKTIAVVNATGRQAASLIRVAAAVGHQVHSLKGLIAEELQAIPNVTLFQGPLLNNVPLMDTLF-EG
1db3A           ----SKVALITGVTGQDGSYLAEFLLEKGYEVHGIKHLHYGDLSDTSNLTRILREVQPDEVYNLGAMS-H
1a2zA           ------KVLITGFEPFGGDSKNPTEQIAKYFDRKQIGNAMVYGRVLPVSVKRATIELKRYLEEIKPEIVI
1ujmA           VLPEGSLVLVTGANGFVASHVVEQLLEHGYKVRGTARSKRWDAKYPGRFETAVVEDXLKQGAYDEVIKGA
1qycA           ------RILLIGATGYIGRHVAKASLDLGHPTFLLVRESTASSNSEKAQLLESFKASGANIVHGSIDDHA
2a35A1          ------RVLLAGATGLTGEHLLDRILSEPTLAKVIAPARKPRLDNPVGPLAELLPQLDGSIDTAFCCLGT
1aorA1          YPVKNQTGVYPYAYEQSGEAMAAKYLVRNKPCYACPIGPTVGETEGPEYESVWALGANLGINDLASIIEA
1u9jA           ------RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRFLNHPHFHFVEGDISIHSEVAIATP
1hdoA           ------KIAIFGATGQTGLTTLAQAVQAGYE-VTVLVRDSSRLPSEGPRPAHVVVGDVLQAADVDKTVAG
1eq2A           -------IIVTGGAGFIGSNIVKALNDKGITDILVVDNIADYMDKEDFLIQIMAGEEFGDVEAIFHEGAX
1i24A           ----------------------------------------------------------------------
1pfsA           ----------------------------------------------------------------------
2bkaA1          ------SVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQ
1xq6A           -----PTVLVTGASGRTGQIVYKKLKEGSDKFVAKGGKEKIDITDADSINPAFQGIDALVILTSAVMKPG
1c3vA1          ------RVGVLGAKGKVGTTMVRAVAAADD-LTLSAEL--------------------------------
1vm6A3          ------KYGIVGYSGRMGQEIQKVFSEKGHELVLKVDV--------------------------------
2hjsA1          ---QPLNVAVVGATGSVGEALVGLLDERDF-PLHRLHL--------------------------------


                         .         .         *         .         .         .         .:140
query           IYYNLKYKADFITENLQIQTNLIHGAYKCGIKDLIFLGSSCVYPKNCKQPIKETYLLSGKLEETNDAYAI
1bsvA           IVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPYAI
1vl0A           DKCEEQYDLAYKI-NAIGPKNLAAAAYSVG-AEIVQISTDYVFDGEAKEPITEFDEVN-----PQSAYGK
1sb8A           VPRSINDPITSNATNIDGFLNMLIAARDAKVQSFTYAASSSTYGDHPGLPKVEDT-----IGKPLSPYAV
1bxkA           VDRSIDGPAAFIETNIVGTYTLLEAARKKSAFRFHHISTDEVYG---DLHSTDDFFTETTPYAPSSPYSA
2b69A1          DQINYXYNIKTLKTNTIGTLNXLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIG-PRACYDE
1kbzA           AVDKAESEPELAQLLNATSVEAIAKAANETGAWVVHYSTDYVFPGTGDIPWQETDATS-----PLNVYGK
1orrA           TTSIDNPCMDFEINVGGTLNLLEAVRQYNSNCNIIYSSTNKVYGDLEQYKYNETETRYTCVDKPNGPYGC
1k6iA           AHLAFINTTSQAGDEIAIGKDLADAAKRAGTIQHYIYSSMPDHSLYGPW--------------PAVPMWA
1db3A           VAVSFESPEYTADVDAMGTLRLLEAIRFLGLERFYQASTSELYGLVQEIPQKETTPF-----YPRSPYAV
1a2zA           NLGRIAVNIIDARIPDNDGYQPIDEKIEEDAPLAYMATLPVRAITKTLRDNGIPA---------------
1ujmA           AGVFSNKYDEVVTPAIGGTLNALRAAAATPSKRFVLTSSTVSALIPKPNVEGIYLDEKSDPQKSLWVYAA
1qycA           SLVEAVKNVDVVISTIESQVNIIKAIKEVGTVKRFFPSEFGNDVDNVHAVEPAKSVFEVK----------
2a35A1          TIKEAGSEEAFRAVDFDLPLAVGKRALEMGARHYLVVSALGADAKSSIF------------------YNR
1aorA1          NHMCDELGLDTISTGGTLATAMELYEKLGDAPPFRWGNTEVLHYYIEKIAKREGFKLAEGSYRLAESYGH
1u9jA           IEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYGMCSDKYFDEDHSNLIVGPVNKPRWIYSV
1hdoA           QDLGTRNDLSPTTVMSEGARNIVAAMKAHGVDKVVACTSAFLLWD----------------PTKVPPRLQ
1eq2A           SSTTEWDGKYMMDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSDFIESREYE------KPLNVYGY
1i24A           ----------------------------------------DIEEGYITITHNGRTDTLPYPKQASSFYHL
1pfsA           ----------------------------------------------------------------------
2bkaA1          GHDVGFCCLGT----------TRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLSKGADKSSNFLYLQ
1xq6A           FDPTKGGRPEFIFEDGQYQKNQIDAAKVAGVKHIVVVGSMGGTNPDH-----------------------
1c3vA1          ----------------------------------------------------------------------
1vm6A3          ----------------------------------------------------------------------
2hjsA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AKIAGIKMCQSYNEQYKTKYKCLMPTNTYGPNDNYDKNNSHFIPAXXXXXXXXXXXXXNTVILWGNGKAK
1bsvA           AKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQNAPDVVVWGSGTPM
1vl0A           TKLEGENFVKALNPKYYI----VRTAWLYGDGNNFVKTXINLGKTHDEL----------KVV----HDQV
1sb8A           TKYVNELYADVFSRCYGFSTIGLRYFNVFGRRQDPNGAYAAVIPK-----WTSSMIQGDDVYINGDGETS
1bxkA           SKASSDHLVRAWLRTYGLPTLITNCSNNYGPYHFPEKLIPLMI---------LNALAGKSLPVYGNGQQI
2b69A1          GKRVAETXCYAYXKQEGVEVRVARIFNTFGPRXHXNDGRVVSN-------FILQALQGEPLTVYGSGSQT
1kbzA           TKLAGEKALQDNCPKHLI----FRTSWVYAGKGNNFAKTMLRLAKERQTL---------SVINDQYGAPT
1orrA           SKGAADQYMLDYARIFGLNTVVFRHSSMYGGRQ-FATYDQGWVGWFCQKAVEIKNGINKPFTISGNGKQV
1k6iA           PKFTVENYVRQLGLPSTF----VYAGIYNNNFTSLPYPLFQMELM---------PDGTFEWHAPFDPDIP
1db3A           AKLYAYWITVNYRESYGMYACNGILFNHESPRRGETFVTRKITRA-----IANIAQGLESCLYLGNMDSL
1a2zA           -------TISYSAGTYLCNYVMFKTLHFSKIEGYPLKAGFIHVPYTPD----------QVVNKFFLLGKN
1ujmA           SKTEAELAAWKFXDENKPHFTLVLPNYTIGTIFDPETQSGS-------TSGWXXSLFNGEVSPALALXPP
1qycA           ------AKVRRAIEAEGIPYTYVSSNCFAGYFLRSLAQAGLTAPP------------RDKVVILGDGNAR
2a35A1          VKGELEQALQEQ---GWPQLTIARPSLLFGPREEF--RLAEILAAPIAGKYHGIEACDLARALWREEGKG
1aorA1          PELSMTVKKLELPAYD---PRGAEGHGLGYATNNRGGCHIKNYMISPEILGYPYKMDPHSDDKIKMLILF
1u9jA           SKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNAARIG-SSRAITQLILNLVEGSPIKLIDGGKQK
1hdoA           AVTDDHIRMHKVLRESGLKYVAVMPPHIGDQPLTG------------------------AYTVTLDGRGP
1eq2A           SKFLFDEYVRQILPEANSQIVGFRYFNVYGPREGHKGSMASVAFH-----------------LNTQLNNK
1i24A           SKVHDSHNIAFTCKAWGIRATDLNQGVVYGVKTDETEMHEELRNRLDYDAVFGTALNRFCVQVYGKGGQT
1pfsA           -------------------------------------------------------------VRQGTSAKG
2bkaA1          VKGEVEAKVEEL---KFDRYSVFRPGVLLCDRQESRPGEWLV---------------RKFFGSLPDSWAS
1xq6A           ----------------------------------------------------------------------
1c3vA1          ----------------------------------------------------------------------
1vm6A3          ----------------------------------------------------------------------
2hjsA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           REVIHVDDIAEACIFFMKKKTEHFLINIGTGKDYSIKYYLEFIAKVILGNXXXXXXXXXXXPNGSPRKVM
1bsvA           REFLHVDDMAAASIHVMELQPMLSHINVGTGVDCTIRELAQTIAKVV--GYKGRVVFDASKPDGTPRKLL
1vl0A           GTPTSTVDLARVVLKVIDEK--------------------------------------------------
1sb8A           RDFCYIENTVQANLLAATAGLDNQVYNIAVGGRTSLNQLFFALRDGLAENGVSYHREPVYRDGDVRHSLA
1bxkA           RDWLYVEDHARALYCVATTGKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGVAHYRDLTFRYAI
2b69A1          RAFQYVSDLVNGLVALXNSNVSS-PVNLGNPEEHTILEFAQLIKNLV--GSGSEIQFLSEAQDDPQKRKP
1kbzA           GAELLADCTAHAIRVALNKPEVAGLYHLVAGGTTTWHDYAALVFDE-ARKAGITLALTELNAVPTGNSRL
1orrA           RDVLHAEDMISLYFTALANKIRGNAFNIGGTIVNSLSLLELFKLLEDYCNIDMRFTNLPVRESDQRVFVA
1k6iA           LPWLDAEHDVGPQIFKDGPQKWNGHRIALTFETLSPVQVCAAFSRALEQLEAIEVVFGEHKAPYFPLPEF
1db3A           RDWGHAKDYVKMQW-MMLQQEQPEDFVIATGVQYSVRQFVEMAAAQL-----------------------
1a2zA           TPSMCLEAEIKAIELAVKVSLDY-----------------------------------------------
1ujmA           QYYVSAVDIGLLHLGCLVLPQIERRRVYGTAGTFDWNTVLATFRKLYPSKTFPADFPDQGQDLSKFDTAP
1qycA           VVFVKEEDIGTFTIKAVPRTLNKTLYLRLPANTLSLNELVALWEKKI-----------------------
2a35A1          VRFVESDELRK-----------------------------------------------------------
1aorA1          QDLTALIDSAGLCLFTTFGLGARDLLNAALGWDFTTEDYLKIGERIWERLFNLKAGLDPARDDTLPKRFL
1u9jA           RCFTDIRDGIEALYRIINRCDGEIINIGNPENEASIEELGEMLLASFPLRHHFPPFAGFRVVESVEHRKP
1hdoA           SRVISKHDLGHFMLRCLTDEYDGHSTYPS-----------------------------------------
1eq2A           RDFVYVGDVADVNLWFLENGV-SGIFNLGTGRAESFQAVADATYQA-------------------FTQAD
1i24A           RGYLDIRDTVQCVEIAIANPAGEFRVFNQFTEQFSVNELASLVTKAGGLDVKKMTVPNPRVEAEEHYYNA
1pfsA           NPYTFQEGFLHLEDKPHPLQCQFFRINVNNGRPELAFDFKAMK---------------------------
2bkaA1          GHSVPVVTVVRAMLNNVVRPRDKQMELLENKAIHDL----------------------------------
1xq6A           ----------------------------------------------------------------------
1c3vA1          ----------------------------------------------------------------------
1vm6A3          ----------------------------------------------------------------------
2hjsA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           DISLAKKYGWKSKMSLITSIRNTYKSFVRENF
1bsvA           DVTRLHQLGWYHEISLEAGLASTYQWF-LEN-
1vl0A           --------------------------------
1sb8A           DISKAAKLGYAPKYDVSAGVALAYIMFLK---
1bxkA           DASKIARLGCVPQETFESGMRKTVQWYL----
2b69A1          DIKKAKLLGWEPVVPLEEGLNKAIHYF-RKEL
1kbzA           NTEKFQRFDLILP-QWELGVKRMLTEM-FTT-
1orrA           DIKKITNADWSPKVSAKDGVQKMYD-------
1k6iA           SRVTDEAKLWSGWRDMEEYAREVFPIEEE---
1db3A           --------------------------------
1a2zA           --------------------------------
1ujmA           SLEILKSLGRPGWRSIEESIKDLVGSE-----
1qycA           --------------------------------
2a35A1          --------------------------------
1aorA1          EEPMPEGPNKGHTVRLKEMLPRYYKLR-GWT-
1u9jA           SIRNAHRCDWEPKIDMQETIDETLDFF-LRT-
1hdoA           --------------------------------
1eq2A           LTNLRAAGYDKPFKTVAEGVTEYMAWL-----
1i24A           KHTKLMELGLEPHYSLLDSLLNFAVQF-----
1pfsA           --------------------------------
2bkaA1          --------------------------------
1xq6A           --------------------------------
1c3vA1          --------------------------------
1vm6A3          --------------------------------
2hjsA1          --------------------------------