[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for pubi0:AAZ21413.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1konA.bssp"
#ERROR : Can't open dsspfile "1mw7A.bssp"

## Summary of PDB Search
:241
    2e-65  36%  1konA  [e.39.1.1] PROTEIN YEBC
    9e-29  28%  1mw7A  [e.39.1.1] HYPOTHETICAL PROTEIN HP0162
:241

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxGHSKWASIKHSKGKADKQRSKVFSKLSKEISVAAKLGDKDPAMNPRLRSAIQAAKSANMPKDNIERAI
1konA           --GHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLD-----ANPRLRAAVDKALSNNMTRDTLNRAI
1mw7A           ----------------------KVFPKLAKAITLAAKDGGSEPDTNAKLRTAILNAKAQNMPKDNIDAAI


                         .         .         *         .         .         .         .:140
query           AKSSVNSETNYENLRYEGFGPDKIAVIVEALTDNKNRTASNVRSIFVKSGGNLGTQGSASHNFNQLGXXX
1konA           AR-----GANMETIIYEGYGPGGTAIMIECLSDNRNRTVAEVRHAFSKCGGNLGTDGSVAYLFSKKG--V
1mw7A           -KRASSKEGNLSEITYEGKANFGVLIIMECMTDNPTRTIANLKSYFNKQGASIVPNGSLEFMFNRKSKNE


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXXFELAIESGADECISNDEFHEIQCPMSEIYNVKKNLEKTIANFISTEIEWVPLNSVDVEK
1konA           ISFEKGDEDTIMEAALEAGAEDVVTYDGAIDVYTAWEEMGKVRDALEAAGLKADSAEVSMIPSTKADMDA
1mw7A           VENLKLSLEDLEFALIDYGLEELEEVEDKIIIRGDYNSFKLLNEGFESLKLPILKASLQRIATTPIELND


                         .         .         .         +         .         .         .:280
query           DKVXXXXXXXXXXXXXXXVQSVYSNINFxxx
1konA           ETAPKLMRLIDMLEDCDDVQEVYHNGEI---
1mw7A           EQMELTEKLLDRIEDDDDVVALYTNI-----