[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for pubi0:AAZ21432.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2apjA1.bssp"
#ERROR : Can't open dsspfile "1b0pA2.bssp"
#ERROR : Can't open dsspfile "1ni4A.bssp"
#ERROR : Can't open dsspfile "1dtwA.bssp"
#ERROR : Can't open dsspfile "1dtwB1.bssp"
#ERROR : Can't open dsspfile "1l8aA1.bssp"
#ERROR : Can't open dsspfile "1ay0A2.bssp"
#ERROR : Can't open dsspfile "1ay0A1.bssp"
#ERROR : Can't open dsspfile "1um9A.bssp"
#ERROR : Can't open dsspfile "2np5A2.bssp"
#ERROR : Can't open dsspfile "1jscA2.bssp"
#ERROR : Can't open dsspfile "1ozfA3.bssp"
#ERROR : Can't open dsspfile "1upaA3.bssp"
#ERROR : Can't open dsspfile "1powA3.bssp"
#ERROR : Can't open dsspfile "2c31A2.bssp"
#ERROR : Can't open dsspfile "1ay0A3.bssp"
#ERROR : Can't open dsspfile "1dtwB2.bssp"
#ERROR : Can't open dsspfile "1csmA.bssp"
#ERROR : Can't open dsspfile "2p8tA2.bssp"
#ERROR : Can't open dsspfile "1zpdA3.bssp"
#ERROR : Can't open dsspfile "1c7sA2.bssp"
#ERROR : Can't open dsspfile "1ovmA3.bssp"
#ERROR : Can't open dsspfile "2c31A3.bssp"
#ERROR : Can't open dsspfile "1l8aA3.bssp"
#ERROR : Can't open dsspfile "1b0pA3.bssp"
#ERROR : Can't open dsspfile "1bfdA3.bssp"
#ERROR : Can't open dsspfile "1upaA2.bssp"
#ERROR : Can't open dsspfile "3cr3C1.bssp"
#ERROR : Can't open dsspfile "1q18A2.bssp"

## Summary of PDB Search
:637
    5e-45  15%  2apjA1 [c.23.10.7] PUTATIVE ESTERASE A:17 -- 260
    3e-43  11%  1b0pA2 [c.36.1.12] PROTEIN (PYRUVATE-FERREDOXIN OXIDOREDUCTASE)
    2e-42  15%  1ni4A  [c.36.1.11] PYRUVATE DEHYDROGENASE E1 COMPONENT: ALPHA
    4e-40  15%  1dtwA  [c.36.1.11] BRANCHED-CHAIN ALPHA-KETO ACID DEHYDROGENASE
    7e-39  17%  1dtwB1 [c.36.1.7] BRANCHED-CHAIN ALPHA-KETO ACID DEHYDROGENASE B:17
    1e-38  17%  1l8aA1 [c.36.1.10] PYRUVATE DEHYDROGENASE E1 COMPONENT A:56 -- 470
    1e-31  19%  1ay0A2 [c.36.1.6] TRANSKETOLASE A:338 -- 534
    4e-31  28%  1ay0A1 [c.36.1.10] TRANSKETOLASE A:3 -- 337
    5e-28  16%  1um9A  [c.36.1.11] 2-OXO ACID DEHYDROGENASE ALPHA SUBUNIT
    9e-27  13%  2np5A2 [a.121.1.1] TRANSCRIPTIONAL REGULATOR A:78 -- 195
    4e-26  14%  1jscA2 [c.36.1.5] ACETOHYDROXY-ACID SYNTHASE A:83 -- 270
    2e-23  15%  1ozfA3 [c.36.1.9] ACETOLACTATE SYNTHASE, CATABOLIC A:367 -- 554
    1e-22  11%  1upaA3 [c.36.1.9] CARBOXYETHYLARGININE SYNTHASE A:375 -- 572
    9e-22  14%  1powA3 [c.36.1.9] PYRUVATE OXIDASE A:366 -- 593
    2e-21   9%  2c31A2 [c.36.1.5] OXALYL-COA DECARBOXYLASE A:7 -- 194
    9e-21  14%  1ay0A3 [c.48.1.1] TRANSKETOLASE A:535 -- 680
    1e-20  21%  1dtwB2 [c.48.1.2] BRANCHED-CHAIN ALPHA-KETO ACID DEHYDROGENASE
    4e-20  19%  1csmA  [a.130.1.2] CHORISMATE MUTASE
    2e-19  13%  2p8tA2 [d.74.4.2] HYPOTHETICAL PROTEIN PH0730 A:83 -- 199
    2e-19  14%  1zpdA3 [c.36.1.9] PYRUVATE DECARBOXYLASE A:363 -- 566
    9e-19   9%  1c7sA2 [b.2.2.3] BETA-N-ACETYLHEXOSAMINIDASE A:28 -- 200
    3e-18  14%  1ovmA3 [c.36.1.9] INDOLE-3-PYRUVATE DECARBOXYLASE A:356 -- 551
    9e-17  14%  2c31A3 [c.36.1.9] OXALYL-COA DECARBOXYLASE A:370 -- 552
    2e-14  17%  1l8aA3 [c.48.1.1] PYRUVATE DEHYDROGENASE E1 COMPONENT A:701 -- 886
    8e-13  14%  1b0pA3 [c.48.1.3] PROTEIN (PYRUVATE-FERREDOXIN OXIDOREDUCTASE)
    2e-10  21%  1bfdA3 [c.36.1.9] BENZOYLFORMATE DECARBOXYLASE A:342 -- 524
    6e-09  12%  1upaA2 [c.36.1.5] CARBOXYETHYLARGININE SYNTHASE A:12 -- 197
    1e-07  14%  3cr3C1 [c.54.1.2] PTS-DEPENDENT DIHYDROXYACETONE KINASE, C:3 -- 123
    5e-05  19%  1q18A2 [c.55.1.7] GLUCOKINASE A:112 -- 321
:637

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxYKFLKDINFPSDLRKLSENDLQEVSNEVRKEMIDAVSETGGHLGAGLGVVELTVALHYVFDTPNDRL
2apjA1          ----------------------------------------------------------------------
1b0pA2          ----------------------------------------------------AEYGFGMNMSMFARRTHL
1ni4A           ------------REDGLKYYRXXQTVRRXELKADQLYKQKIIRGFCHLCDGQEACCVGLEAGIN-PTDHL
1dtwA           ------EDPHLPKEKVLKLYK-SMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALD-NTDLV
1dtwB1          ----------------------------------------------------------------------
1l8aA1          ------EEQPEYPGNLELERRSAIRWNAIMTVLRASKKDLELGGHMASFQSSATIYDVCFNHFEQDGGDL
1ay0A2          ----------------------------------------------------------------------
1ay0A1          -------------TDIDKLAVS-------TIRILAVDTVSKASGHPGAPLGMAPAAHVLWSQMWINRDRF
1um9A           ------------GEKLRRLYRDML-AARMLDERYTILIRTGKTSFIAPAAGHEAAQVAIAHAIRPGFDWV
2np5A2          ----------------------------------------------------------------------
1jscA2          ----------------------------------------------------------------------
1ozfA3          -------------------------------------------------------------------LRI
1upaA3          -------------------------------------------------HQVIDSXNTVXEEAAEPGEGT
1powA3          -------------------------------------------------------------------YQV
2c31A2          ----------------------------------------------------------------------
1ay0A3          ----------------------------------------------------------------------
1dtwB2          ----------------------------------------------------------------------
1csmA           ---KSFLPSINYPQILAAPEVNYNDKIKKVYIEKIIPLISKRDGDDKNNFGSIECLQSLHFGKFVAEAKF
2p8tA2          ----------------------------------------------------------------------
1zpdA3          ----------------------------------------------------------------------
1c7sA2          ----------------------------------------------------------------------
1ovmA3          -----------------------------------------------------------------PDGSL
2c31A3          ----------------------------------------------SGMMNYSNSLGVVRDFMLANPDIS
1l8aA3          ----------------------------------------------------------------------
1b0pA3          ----------------------------------------------------------------------
1bfdA3          ----------------------------------------------------------------------
1upaA2          ----------------------------------------------------------------------
3cr3C1          ----------------------------------------------------------------------
1q18A2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IWDVGHQTYPHKILTGRKSKIKTLRQGNGLSGFTKRSESEYDPFGAAHSSTSISSALGMAEANKLSNKLN
2apjA1          ----------------------------------------------------------------------
1b0pA2          ADLAAKALESDASGDVKEALQGWLAGKNDPIKSKEYGDKLKKLLA-----GQKDGLLGQIAAMSDLYTKK
1ni4A           IRAHGFTFTRGLSVREILAELTGRKGGCAKGGGSXHXYAKNFYGGNGIVGAQVPLGAGIALACKYNGKDE
1dtwA           FGQYREAGYRDYPLELFMAQCISDLGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANR
1dtwB1          ----------------------------------------------------------------------
1l8aA1          VYFQGHISYARAFLEGRLTQLDNFRQEVHGNGLHPKLMPEFWQFPTVSMGLGPIGAIYQAKFLKYLEHRG
1ay0A2          ----------------------------------------------------------------------
1ay0A1          VLSNGHAVYSMLHLTGYDLSLKQFRQLGSRTPGHPEFELPGVEVTTGPLGQGISNAVGMAMAQANLAATY
1um9A           FPYYRDGIPLKELLGQMLATKADPNKGRQMPEHPGSKA-LNFFTVASPIASHVPPAAGAAISMKLLRTGQ
2np5A2          ----------------------------------------------------------------------
1jscA2          ----------------------------------------------------------------------
1ozfA3          VRAMQDIVNSDVTLTVDMG---SFHIWIARYLYTFRARQVMISNGQQTMGVALPWAIGAW----LVNPER
1upaA3          IVDIGFRHYGVLFARAD----------------------QPFGFLTSAGCSSFGYGIPAAIGAQXARPDQ
1powA3          LRAVNKIAEPDAIYSIDVG---DINLNANRHLKLTPSNRHITSNLFATMGVGIPGAIAAK----LNYPER
2c31A2          ----------------------------------------------------------------------
1ay0A3          ----------------------------------------------------------------------
1dtwB2          ----------------------------------------------------------------------
1csmA           QSD--IPLYTKLIKSKDVEGIMKNITNSA-----------------------------------------
2p8tA2          ----------------------------------------------------------------------
1zpdA3          ----LVNAEIARQVEALLTPNTTVIAETGDSWFNAQRMKLPNGVEYEMQWGHIGWSVPAAFGYAVGAPER
1c7sA2          -------------------------------------QQLVDQLSQLKDNRAGENVDCAALGADWASCNR
1ovmA3          -----TQENFWRTLQTFIRPGDIILADQGTSAFGAIDLRLPADFIVQPLWGSIGYTLAAAFGAQTACPNR
2c31A3          LVNEGAN---ALDNTRMIVDMLKPRKR-------------LDSGTWGVMGIGMGYCVAAAAVTGK-----
1l8aA3          ----------------------------------------------------------------------
1b0pA3          ----------------------------------------------------------------------
1bfdA3          --------------------IYLNESTSTTAQMWQ----RLNMRNPGSYYFCAAGGLGFALPAAIGVQLA
1upaA2          ----------------------------------------------------------------------
3cr3C1          ----------------------------------------------------------------------
1q18A2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           NIIAVIGDGAISAGMAYEAMNNAGASKTKMIVILNDNDMSIAKPVGAMRTYLAKLLTGKIYFSLRETFKL
2apjA1          ----------------------------------------------------------------------
1b0pA2          SVWIFGGDGWAYDIGYGG-LDHVLASGEDVNVFVMDTE------VYSNTGGQSSKATPTGAVAKFA----
1ni4A           VCLTLYGDGAANQGQIFEAYNXAALWKLPCIFICENNRYGXGTSVERAAASTDYYKRGDFIPGLRV----
1dtwA           VVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYDGIAARGPGYGIMSIR-----
1dtwB1          ----------------------------------------------------------------------
1l8aA1          LVYAFLGDGEMDEPESKGAITIATREKLDNVFVINCNLQRLDGPVTGNGKILEGIFEGAGWNVWDELLRK
1ay0A2          ----------------------------------------------------------------------
1ay0A1          NTYVFLGDGCLQEGISSEASSLAGHLKGNLIAIYDDNKITIDGATSISFD--------------------
1um9A           VAVCTFGDGATSEGDWYAGINFAAVQGAPAVFIAENNFPTIADKAHAFGIPGYL-VDGMDVLASYYVVKE
2np5A2          ----------------------------------------------------------------------
1jscA2          ----------------------------------------------------------------------
1ozfA3          KVVSVSGDG--GFLQSSMELETAVRLKANVHLIWVDNGYNMVAIQEEKK---------------------
1upaA3          PTFLIAGDG--GFHSNSSDLETIARLNLPIVTVVVNNDTNGLIELYQNIGHHRSHDP---------AVKF
1powA3          QVFNLAGDGG--ASMTMQDLATQVQYHLPVINVVFTNCQYGFIKDEQEDTN-------------------
2c31A2          ----------------------------------------------------------------------
1ay0A3          ----------------------------------------------------------------------
1dtwB2          ----------------------------------------------------------------------
1csmA           ----------------------------------------------------------------------
2p8tA2          ----------------------------------------------------------------------
1zpdA3          RNILMVGDGSF--QLTAQEVAQMVRLKLPVIILINNYGYTIEVMIH-------DGPYNNIK---NWDYAG
1c7sA2          VLFTLSNDGQAIDGKDWVIYFHSP----RQTLRVDNDQFKIAHLTGDL----YKLEPTAKFSGFPAGKAV
1ovmA3          RVIVLTGDG--AAQLTIQELGSMLRDKQHPILVLNNEGYTVERAIHGAEQ--------------------
2c31A3          PVIAVEGDS--AFGFSGMELETICRYNLPVTVIIMNNGGIYKGNEADPQPGV-------ISCTRLTRGRY
1l8aA3          ----------------------------------------------------------------------
1b0pA3          ----------------------------------------------------------------------
1bfdA3          EVIAVIGDGS--ANYSISALWTAAQYNIPTIFVIMNNG------TYGALRWFAGVLEAENVPGLDVPGID
1upaA2          ----------------------------------------------------------------------
3cr3C1          ----------------------------------------------------------------------
1q18A2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           IVSAFSKRFSVKAGKAEDFLRSAVTGGTLFNSLGFYYVGPIDGHDLSTLIPILKNARDSKHQGPIMIHIK
2apjA1          -------------------------------------GGVFKDHHNNRWVWDKILPPECA--PNSSILRL
1b0pA2          ---------------AAGKRTGKKDLARMVMTYGYVYVATVSMYSKQQFLKVLKEAESFPG--PSLVIAY
1ni4A           ---DGXDILCVREATRFAAAYCRSGKGPILXELQTYRYHGSDPGVSYRTREEIQEVR--SKSDPIXLLKD
1dtwA           ----------VDGNDVFAVTKEARAVAENQPFLIEAMTYRIGHHSTSD--------DSSAYRHPISRLRH
1dtwB1          ----------------------------------------------------------------------
1l8aA1          DTSGYQTFKSKDGAYVREHFFGETAALVADWTDEQIWALNRGGHDPKKIYAAFKKAQETK-GKATVILAH
1ay0A2          ----------------------------------------------------------------------
1ay0A1          ----------------EDVAK-------RYEAYGWEVLYVENGNDLAGIAKAIAQAKLSKDK-PTLIKMT
1um9A           AVERA-----------RRGEGPSLVELRVYRYGPHRKKDPIPRF--------------------------
2np5A2          ----------------------------------------------------------------------
1jscA2          ----------------------------------------------------------------------
1ozfA3          ---------------YQRLSGVEFGPMDFKAYAESFGAKGFAVESAEALEPTLRAAMDVD--GPAVVAIP
1upaA3          GGVDFVALA------------------------EANGVDATRATNREELLAALRKGAE--LGRPFLIEVP
1powA3          -----QNDFIGVEFNDIDFSK-------IADGVHMQAFRVNKIEQ---LPDVFEQAKAIAQHEPVLIDAV
2c31A2          ----------------------------------------------------------------------
1ay0A3          ----------------------------------------------------------------------
1dtwB2          ----------------------------------------------------------------------
1csmA           ----------------------------------------------------------------------
2p8tA2          ----------------------------------------------------------------------
1zpdA3          LMEVFNGNGGYDSGAAKGL--KAKTGGELAEAI-------------------KVALAN--TDGPTLIECF
1c7sA2          EIPVVAEYWQLFRNDFLPRWYATSGDANTDTENLDQFVAPFTGDQWKRTKDDKNILMT-----PASRFV-
1ovmA3          ----------------RYNDIALWNWTHIPQALSLDPQSEWRVSEAEQLADVLEKVA--HHERLSLIEVM
2c31A3          ------------DMMMEAF--------------GGKGY-VANTP--AELKAALEEAVASG--KPCLINAM
1l8aA3          ----------------------------------------------------------------------
1b0pA3          ----------------------------------------------------------------------
1bfdA3          FRA-------------------------LAKGYGVQAL---KADNLEQLKGSLQEALSAK--GPVLIEVS
1upaA2          ----------------------------------------------------------------------
3cr3C1          ----------------------------------------------------------------------
1q18A2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           TQKGKGYSYAEKASDHYHGVSKFNVVTGEQVKSGTNLPAYTKVFANTLVKHAERDSKVVGVTAAMPGGTG
2apjA1          SADLRWEEAHEPLHVDIDTGKVCGV-------------GPGMAFANAVKNRLETDSAVIGLVPCASGGTA
1b0pA2          ATCINQGLDVMNTAVKSGYWPLFRYDPRLAAQGKNPFQLDSKAPDGSVEEFLMAQNRFAVLDRSFPEDAK
1ni4A           RXVNSNLASVEELKEIDVEVRKEIEDAAQFATADPEPPLGYHIYSSDPPFEVRGANQWIKFKSV------
1dtwA           YLLSQGWWDEEQEKAWRKQSRRKAFEQAERKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYP
1dtwB1          -------------------------------------MNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGT
1l8aA1          TIKGYGMGDAAMD-GVRHIRDRFNVPVSDADIE--KLPYITFPESEEHTYLHAQRQKLHGYLPSRQPN--
1ay0A2          -------------------------------TAKDSAVATRKLSETVLEDVYNQLPELIGGSAWKEALDF
1ay0A1          TTIGYGSLHAGSHSVA------------------------------------------------------
1um9A           ----------------------------------------------------------------------
2np5A2          ----------------------------------------------------------------------
1jscA2          --------------------------------------TGGQIFNEMMSRQNVD------TVFGYPGGAI
1ozfA3          VDYRDNPLLMGQ----------------------------------------------------------
1upaA3          VNYDFQPGGFG-----------------------------------------------------------
1powA3          ITGDRPL-PAEKLRLDSAMSSAADI---------------------------------------------
2c31A2          ----------------------------------------ELTDGFHVLIDALKMNDIDTM-YGVVGIPI
1ay0A3          ----------------------------------------------------------------------
1dtwB2          ----------------------------------------------------------------------
1csmA           ----------------------------------------------------------------------
2p8tA2          ----------------------------------------------------------------------
1zpdA3          IGREDCTEELVKWGKRVAAANSRK----------------------------------------------
1c7sA2          ----------------------------------------------------------------------
1ovmA3          LPKADIPPLLGALTKALE----------------------------------------------------
2c31A3          IDPDAGV---------------------------------------------------------------
1l8aA3          ----------------------------------------------------------------------
1b0pA3          ----------------------------------------------------------------------
1bfdA3          T---------------------------------------------------------------------
1upaA2          ---------------------------------------------------------------GVVGREA
3cr3C1          ----------------------------------------------------------------------
1q18A2          --------------------AEIGHVSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSCT


                         .         .         .         .         *         .         .:420
query           MDIFAKDFPKRMFDVGIAEQHAVTFAAGLATEGYKPYVAIYSTFLQRAYDQVVHDVAIQSLPVRFIIDRA
2apjA1          IKEWER--GSHLYERMVKRTEAVLWYQGESDVLDIHDAESYGNNMDRLIKNLRHDLNLPSLPIIQVAASG
1b0pA2          RFKELEHMAATNIFESFAPAGGKADGSVDFGEGAEFCTRDDTPMMARPDSGEACD-----------QNRA
1ni4A           ----------------------------------------------------------------------
1dtwA           LDHFDK----------------------------------------------------------------
1dtwB1          VGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAIQFADYIFPAFDQIVNEAALFNCGSLTIRSPW
1l8aA1          ----------------------------------------------------------------------
1ay0A2          QPPGSGNYSGRYIRYGIREHAMGAIMNGISAFGANYKPYGFLNFVSYAAGAVRLSALSGHPVIWVATHDS
1ay0A1          ----------------------------------------------------------------------
1um9A           ----------------------------------------------------------------------
2np5A2          ----------------------------------------------------------------------
1jscA2          LPVYIHNSDKFNFVLPKHEQGAGHMAEGYARASGKPGVVLVTSGPGATNVVPMADAFADGIPMVVFTGQV
1ozfA3          ----------------------------------------------------------------------
1upaA3          ----------------------------------------------------------------------
1powA3          ----------------------------------------------------------------------
2c31A2          TNLAMWQDDGQRFYSFRHEQHAGYAASIAGYIEGKPGVCLTVPGFLNGVTSLAHATTNCFPMILLSGSSE
1ay0A3          ----------------------------------------------------------------------
1dtwB2          ----------------------------------------------------------------------
1csmA           ----------------------------------------------------------------------
2p8tA2          ----------------------------------------------------------------------
1zpdA3          ----------------------------------------------------------------------
1c7sA2          ----------------------------------------------------------------------
1ovmA3          ----------------------------------------------------------------------
2c31A3          ----------------------------------------------------------------------
1l8aA3          ----------------------------------------------------------------------
1b0pA3          ----------------------------------------------------------------------
1bfdA3          ----------------------------------------------------------------------
1upaA2          ASILFDEVEGIDFVLTRHEFTAGVAADVLARITGRPQACWATLGPGXTNLSGIATSVLDRSPVIALAAQS
3cr3C1          ----------------------------------------------------------------------
1q18A2          DCRRALSLFCVIXGRFGGNFGGVFIAGGIVPRFLEFFKA--SGFRAAFEDKGRFKEYVHDIPVYLIVDNP


                         .         .         +         .         .         .         .:490
query           GLVGADGSTHAGSFDITYLSTLPNFIVMAPSDEAELVKMTNTSMTINNKPCAIRYPRGNGIGVELPSIDE
2apjA1          GGYIDKVREAQLGLKLSNVVCVDAKGLPLKSDNLHLTTE-------AQVQLGLSL---------------
1b0pA2          GTSEQQGDLSKR----------------------------------------------------------
1ni4A           ----------------------------------------------------------------------
1dtwA           ----------------------------------------------------------------------
1dtwB1          G-CVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIE-DKNPCIFFEPKILYRAAAEEVPIE
1l8aA1          ----------------------------------------------------------------------
1ay0A2          IGVGEDGPTHQPIETLAHFRSLPNIQVWRPADGNEVSAAYKNSLESKHTPSIIALSRQN-----------
1ay0A1          ----------------------------------------------------------------------
1um9A           ----------------------------------------------------------------------
2np5A2          --------------ALFAAXS-----QLLPLDEARSREAAAFAVRAATSPSLAEIRRKTLFTIRTGLSAV
1jscA2          PTSAIGTDAFQEADVVGISRSCTKWNVMVKSVELRINEAFEIATSGRPGPVLVDLPKDVTAAILRNPIPT
1ozfA3          ----------------------------------------------------------------------
1upaA3          ----------------------------------------------------------------------
1powA3          ----------------------------------------------------------------------
2c31A2          RIVDLQQGDYEEMDQMNVARPHCKASFRIIKDIPIGIARARTAVSGRPGGVYVDLPAKLFGQTISVEEAN
1ay0A3          ---------------------------------------------------------------EGSSIES
1dtwB2          ----------------------------------------------------------------------
1csmA           ----------------------------------------------------------------------
2p8tA2          ---------FSEPIG-VSVDGYPGIAIVVKNPPEFKSIELRDEAIKFDAKGAMILTVKDNEIVFRPLKEM
1zpdA3          ----------------------------------------------------------------------
1c7sA2          ----------------------------------------------------------------------
1ovmA3          ----------------------------------------------------------------------
2c31A3          ----------------------------------------------------------------------
1l8aA3          ----------------------------------------------------------------------
1b0pA3          ----------------------------------------------------------------------
1bfdA3          ----------------------------------------------------------------------
1upaA2          ESHDIFPNDTHQCLDSVAIVAPXSKYAVELQRPHEITDLVDSAVNAAXTPSFISLPV-------------
3cr3C1          ----------------------------------------------------------------------
1q18A2          GLLGS-----------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           NIEIGKGRVIQEGKQVCILSIGTRLEECKIAAAELKNKGIESTIVDARFAKPLDQELILKCAREHEAMIT
2apjA1          ----------------------------------------------------------------------
1b0pA2          ----------------------------------------------------------------------
1ni4A           ----------------------------------------------------------------------
1dtwA           ----------------------------------------------------------------------
1dtwB1          ----------------------------------------------------------------------
1l8aA1          ----------------------------------------------------------------------
1ay0A2          ----------------------------------------------------------------------
1ay0A1          ----------------------------------------------------------------------
1um9A           ----------------------------------------------------------------------
2np5A2          LIGIGTPEAETRAALLLATVDGLALDAIG-SPALYPPEYL-EHALDIQIGXILQGADVV-----------
1jscA2          KTTL------------------------------------------------------------------
1ozfA3          ----------------------------------------------------------------------
1upaA3          ----------------------------------------------------------------------
1powA3          ----------------------------------------------------------------------
2c31A2          KLLF------------------------------------------------------------------
1ay0A3          ASKGGYVLQDVANPDIILVATGSEVSLSVEAAKTLAAKNIKARVVSLPDFFTFDKQPLEYRLSDNVPIMS
1dtwB2          -IPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKGVSCEVIDLRTIIPWDVDTICKSVIKTGRLLI
1csmA           ----------------------------------------------------------------------
2p8tA2          YPEVAKKIVDYEDGDAVIITWAETPAKAIHVAYILKKEEITPEILE------------------------
1zpdA3          ----------------------------------------------------------------------
1c7sA2          ----------------------------------------------------------------------
1ovmA3          ----------------------------------------------------------------------
2c31A3          ----------------------------------------------------------------------
1l8aA3          --GIRKGTIEGSKGKVQLLGSGSILRHVREAAEILAKYGVGSDVYSVTSFTELARDGQDCERWNTPRVPY
1b0pA3          --------VGAPDAERVIVSMGSSCETIEEVINHLAAKGEKIGLIKVRLYRPFVSEAFFAALPASAKVIT
1bfdA3          ----------------------------------------------------------------------
1upaA2          ----------------------------------------------------------------------
3cr3C1          ---------------IVIVSHSPEIASGLKKLIREVAKNISLTAIGGLENGEIGTSFAIEENEADNLLTF
1q18A2          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           VEEGSIGGFGSHVENLLSEKGIFDKGLKFRTMILPDIFIEQDSPKKMYDVAGLNASQISKKILDILFTKE
2apjA1          ----------------------------------------------------------------------
1b0pA2          ----------------------------------------------------------------------
1ni4A           ----------------------------------------------------------------------
1dtwA           ----------------------------------------------------------------------
1dtwB1          ----------------------------------------------------------------------
1l8aA1          ----------------------------------------------------------------------
1ay0A2          ----------------------------------------------------------------------
1ay0A1          ----------------------------------------------------------------------
1um9A           ----------------------------------------------------------------------
2np5A2          ----------------------------------------------------------------------
1jscA2          ----------------------------------------------------------------------
1ozfA3          ----------------------------------------------------------------------
1upaA3          ----------------------------------------------------------------------
1powA3          ----------------------------------------------------------------------
2c31A2          ----------------------------------------------------------------------
1ay0A3          VEVLATTCWGKYA----------------HQSFGIDRFGASGKAPEVFKFFGFTPEGVAERAQKTIAFYK
1dtwB2          SHEPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPF----PHIFEPFYIPDKWKCYDALRKMI----
1csmA           ----------------------------------------------------------------------
2p8tA2          ----------------------------------------------------------------------
1zpdA3          ----------------------------------------------------------------------
1c7sA2          ----------------------------------------------------------------------
1ovmA3          ----------------------------------------------------------------------
2c31A3          ----------------------------------------------------------------------
1l8aA3          IAQAPAVASTDYMKLFAEQVRTYVPADDYR-VLGTDGFGRSDSRENLRHHFEVDASYVVVAALGEL----
1b0pA3          VLDTKEPGAPGDPLYLDVCSAFVERGEAMPKILAGRYGLGSKEFSPAMVKS--VYDNMSGAKKNHF----
1bfdA3          ----------------------------------------------------------------------
1upaA2          ----------------------------------------------------------------------
3cr3C1          FDLGSARXNLDLVSE----------XTDKELTIFNVPLIEGAYTASALLEAGATFEAIKEQLEKXL----
1q18A2          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           SIKVVKx
2apjA1          -------
1b0pA2          -------
1ni4A           -------
1dtwA           -------
1dtwB1          -------
1l8aA1          -------
1ay0A2          -------
1ay0A1          -------
1um9A           -------
2np5A2          -------
1jscA2          -------
1ozfA3          -------
1upaA3          -------
1powA3          -------
2c31A2          -------
1ay0A3          GDKLIS-
1dtwB2          -------
1csmA           -------
2p8tA2          -------
1zpdA3          -------
1c7sA2          -------
1ovmA3          -------
2c31A3          -------
1l8aA3          -------
1b0pA3          -------
1bfdA3          -------
1upaA2          -------
3cr3C1          -------
1q18A2          -------