[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for pubi0:AAZ21456.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1jhcA.bssp"
#ERROR : Can't open dsspfile "1ay9A.bssp"
#ERROR : Can't open dsspfile "1f39A.bssp"

## Summary of PDB Search
:131
    3e-20  30%  1jhcA  [b.87.1.1] LEXA REPRESSOR
    4e-20  34%  1ay9A  [b.87.1.1] UMUD PROTEIN
    2e-10  22%  1f39A  [b.87.1.1] REPRESSOR PROTEIN CI
:131

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxIPFYLHKAGAGFPSPATDYIEEDVDLNVHLIKNVPATFIIRVQGKSMTDVGIYDGDLLVIDRSLKP
1jhcA           ----LPLV-GRVAAGEPLLAQQHIEGHYQVDPSLFKP-NADFLLRVSGMAMKDIGIMDGDLLAVHKTQDV
1ay9A           ---------------------DYVEQRIDLNQLLIQHPSATYFVKASGDSMIDGGISDGDLLIVDSAITA
1f39A           --------------------------------------ASAFWLEVEGNSMTKPSFPDGMLILVDPEQAV


                         .         .         *         .         .         .         .:140
query           KNFSTVVANVHDELVVKSFVRSKDGQFLTSGSKNIEDKIIIGDESEVFIWGVVTYVIHxxx
1jhcA           RNGQVVVARIDDEVTVKRLKKQGNKVELLPENSEFKPIVVDLRQQSFTIEGLAVGVIR---
1ay9A           SHGDIVIAAVDGEFTVKKLQL-RPTVQLIPMNSAYSP-ITISSEDTLDVFGVVIHVVK---
1f39A           EPGDFCIARLGDEFTFKKLIRDSGQVFLQPLNPQYPMIPCNE---SCSVVGKVIASQW---