[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for pubi0:AAZ21597.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1gttA1.bssp"
#ERROR : Can't open dsspfile "1nkqA.bssp"
#ERROR : Can't open dsspfile "1sv6A.bssp"
#ERROR : Can't open dsspfile "1hyoA2.bssp"

## Summary of PDB Search
:281
    6e-54  25%  1gttA1 [d.177.1.1] 4-HYDROXYPHENYLACETATE DEGRADATION BIFUNCTIONAL
    2e-48  28%  1nkqA  [d.177.1.1] HYPOTHETICAL 28.8 KDA PROTEIN IN PSD1-SKO1
    1e-41  16%  1sv6A  [d.177.1.1] 2-KETO-4-PENTENOATE HYDRATASE
    8e-41  19%  1hyoA2 [d.177.1.1] FUMARYLACETOACETATE HYDROLASE A:119 -- 416
:281

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxISKP
1gttA1          ---------------------------------------------------------------------K
1nkqA           ------------------------------------------------------------------LKAA
1sv6A           ---------------------------------------------------------------------R
1hyoA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKKLDHEVEIAFVIGKKAKRVLE
1gttA1          GTIFAVALNHRSQLDAWQEAPPKTAVWFIKPRNTVIGCGEPIPFPQGEK-VLSGATVALIVGKTATKVRE
1nkqA           RKIICIGRNYAAHIKELNNQ----PFFFLKPTSSIVTPLSSSIFIPRGVKVHHEIELALIVSKHLSNVTK
1sv6A           VVGRKVGLTHPKVQQQLGVDQPDFGTLFA---DMCYGDNEIIPFSR-VLQPRIEAEIALVLNRPATDITF
1hyoA2          -----VGIMFRGKENALLPNWLHLPVGYHGRASSIVVSGTPIRRPMGCRLLDMELEMAFFVGPFGEPIPI


                         +         .         .         .         .         *         .:210
query           KDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGPLGPYLVTKDEIQXXXXXXXXXXXXGHRHQT
1gttA1          EDAAEYIAGYALANDVSLPEES--FYRPAIKAKCRDGFCPIGETVALSN----VDNLTIYTEINGRPADH
1nkqA           EEVYDSISGVALALDLTARNVQKKKGLPWTISKGFDTFXPISAIVSREKFSNLQDIFRVKCSVNGQLRQD
1sv6A           DELYNAIEWVLPALEVVGSRIR-DWSIQFVDTVADNASYVIGGPAQRPAGL-DLKNCAMKMTRNNEEVSS
1hyoA2          SKAHEHIFGMVLMNDWSARDIQQWEYVPLGPFLGKSFGTTISPWVVPMDALNLSVSLKGEGMSQAATICR


                         .         .         .         +         .         .         .:280
query           GNTNQMIFNFNFLVAHITSFITLMPGDIXXXXXXXXXXLGMDPPVFLKEGDEMKLNIDSLGSQNSKVILE
1gttA1          WNTADLQRNAAQLLSALSEFATLNPGDAILLGTPQ-------ARVEIQPGDRVRVLAEGFPPLENPVVDE
1nkqA           GGTNLXLHPLHKILQHISTXISLEPGDIILTG-------TPAGVGELKPGDRVHCELLQNNDN-------
1sv6A           GRGSECLGHPLNAAVWLARKEPLRTGDIILTGALG-------PMVAVNAGDRFEAHIEGIGS--------
1hyoA2          SNFKHMYWTMQQLTHHSVNGCNLRPGDLLASGTISG-------SDPESFGSMLELSWKGTK---------


                         .         *         .         .         .         .         +:350
query           Q
1gttA1          R
1nkqA           -
1sv6A           -
1hyoA2          -