[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for pubi0:AAZ21667.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ivnA.bssp"
#ERROR : Can't open dsspfile "1yzfA1.bssp"
#ERROR : Can't open dsspfile "1vjgA.bssp"
#ERROR : Can't open dsspfile "1bwpA.bssp"
#ERROR : Can't open dsspfile "3dc7A1.bssp"
#ERROR : Can't open dsspfile "2hsjA1.bssp"
#ERROR : Can't open dsspfile "3bzwA1.bssp"
#ERROR : Can't open dsspfile "1deoA.bssp"
#ERROR : Can't open dsspfile "2o14A2.bssp"

## Summary of PDB Search
:204
    9e-25  36%  1ivnA  [c.23.10.5] THIOESTERASE I
    1e-22  22%  1yzfA1 [c.23.10.5] LIPASE/ACYLHYDROLASE A:1 -- 195
    2e-22  20%  1vjgA  [c.23.10.6] PUTATIVE LIPASE FROM THE G-D-S-L FAMILY
    1e-21  12%  1bwpA  [c.23.10.3] PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE
    2e-20  15%  3dc7A1 [c.23.10.9] PUTATIVE UNCHARACTERIZED PROTEIN LP_3323 A:18 --
    4e-18  28%  2hsjA1 [c.23.10.3] PUTATIVE PLATELET ACTIVATING FACTOR A:1 -- 211
    2e-16  16%  3bzwA1 [c.23.10.9] PUTATIVE LIPASE A:38 -- 285
    7e-16  17%  1deoA  [c.23.10.4] RHAMNOGALACTURONAN ACETYLESTERASE
    6e-04  24%  2o14A2 [c.23.10.8] HYPOTHETICAL PROTEIN YXIM A:160 -- 367
:204

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxNVILFGDSLMAGYGLPQEKHLAIVLQNNLNDSGYDLGIIDGSVSGST
1ivnA           ------------------------LLILGDSLSAGYRMSASAAWPALLNDKWSK----TSVVNASISGDT
1yzfA1          ------------------------IVLFGDSITAGYLDEVSPVLVDLVKRDIAAMGLEVAVINAGMPGDT
1vjgA           -----------------------RICFVGDSFVNGTGDPECLGWTGRVCVNANKKGYDVTYYNLGIRRDT
1bwpA           -----------------------EVVFIGDSAVQLMHQC----------EIWRELFSPLHALNFGIGGDS
3dc7A1          -----------------------RPAWLGDSITANNGLA-TVHYHDILAADWDV----ERSDNLGISGST
2hsjA1          -----------------------NILFIGDSIVEYYPLQ-------------ELFGTSKTIVNRGIRGYQ
3bzwA1          ------------------------VGYIGDSITDPNCYGNIKKYWDFLKEWLGITPFVYG-----ISGRQ
1deoA           ------------------------VYLAGDSTMAKNGGGSGTNWGEYLASYLSATVVNDAV-----AGRS
2o14A2          ------------------------IYVGGDSTVCNYYPLNSSKQAQXLPHYIDKHT--FQVRNXASGGQI


                         .         .         *         .         .         .         .:140
query           SAGGLNRVEWSLSQPNIDLMILGLGANDMLRGISPIETEKNLEKIIQTAKLKNIEIILAGMIAPTTHGIS
1ivnA           SQQGLARLPALLKQHQPRWVLVELGGNDGLRGFQPQQTEQTLRQILQDVKAANAEPLLMQIRLPANYGRR
1yzfA1          TEDGLKRLNKEVLIEKPDEVVIFFGANDADRNITVATFRENLETMIHEIGSEKVILITADSGRRPERPQT
1vjgA           SSDIAKRWLQELHKEYNSLVVFSFGLNDTTLEVSIAETIKNTREILTQAKKLYPVLXISPAPYIEQQDRR
1bwpA           TQHVLWRLENGEEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNP
3dc7A1          IGSRYDAXAVRAIPEDADFIAVFGGVNDYGRDQPLGQYGDCDXTTFYGTNWPTVPKLFISAIHIGSDFGY
2hsjA1          TGLLLENLDAHLYGGAVDKIFLLIGTNDIGKDVPVNEALNNLEAIIQSRDYPLTEIKLLS-ILPVNEREE
3bzwA1          WDDVPRQALKKEHGGEVDAILVFXGTNDYNSSVTQDTYRGRINIGITQLKKLFPDKQIVLLTPLHRSCGE
1deoA           ARSYTREGRFEDVVTAGDYVIVEFGHNDGGVNETILTFPAYLENAAKLFTAKGAKVILSSQTWETGTFVN
2o14A2          ARGFRNDGQLEAILKYIDYFXLQLGINDT----NPKHKESVXRDXIRQVKAKGADVIL-----STPQGRA


                         +         .         .         .         .         *         .:210
query           YKKKFDNIYPSLAQKYELNLIPFLLEGVALKPELNQEDGMHPNEKGTIIISDTLTKSIINFIKK
1ivnA           YNEAFSAIYPKLAKEFDVPLLPFFMEEVYLKPQWMQDDGIHPNRDAQPFIADWMAKQL------
1yzfA1          RIKELVKVAQEVGAAHNLPVIDLAMTVYPGTDEFLQADGLHFSQVGYELLGALIVREIKGRLK-
1vjgA           RTIDLSQQLALVCQDLDVPYLDLLEKPSVWLHEAKANDGVHPQAGGYTEFARIVENWD------
1bwpA           LREKNRRVNEALAGHPRAHFLDAFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLL--
3dc7A1          RQSDYEAAIAQXTADYGVPHLSLYTFAIPAQAAIYSVDTLHPNNAGHRVIARKLQSFLDS----
2hsjA1          YQQNWNQAYQELASAYQVEFVPLTDQAGQLKKEY-TTDGLHLSIAGYQALSKSL----------
3bzwA1          YIDAYVQAIKEAGNIWGIPVIDFXVEEQLIYFYDAGYDRLHPDTKGQERXARTLXYQL------
1deoA           SPTRFVEYAELAAEVAGVEYVDHETLGNATVNSYFPIDHTHTSPAGAEVVAEAFLKAVVCTGT-
2o14A2          TDFTSEGIHSSLAEEEKTYLIDLYFTSIRTLGLYXDGDTLHPNRAG----ADALARLAVQELKR