[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for pubi0:AAZ21852.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2b3zA1.bssp"
#ERROR : Can't open dsspfile "2aznA1.bssp"
#ERROR : Can't open dsspfile "1wwrA1.bssp"
#ERROR : Can't open dsspfile "1tiyA.bssp"
#ERROR : Can't open dsspfile "2g84A1.bssp"
#ERROR : Can't open dsspfile "1j3iA.bssp"
#ERROR : Can't open dsspfile "1dioB.bssp"
#ERROR : Can't open dsspfile "2hxvA1.bssp"
#ERROR : Can't open dsspfile "1af2A2.bssp"
#ERROR : Can't open dsspfile "1ox7A.bssp"
#ERROR : Can't open dsspfile "1vq2A.bssp"
#ERROR : Can't open dsspfile "1jtkA.bssp"
#ERROR : Can't open dsspfile "1ai9A.bssp"
#ERROR : Can't open dsspfile "1qzfA1.bssp"
#ERROR : Can't open dsspfile "1vdrA.bssp"
#ERROR : Can't open dsspfile "1af2A1.bssp"

## Summary of PDB Search
:351
    4e-29  28%  2b3zA1 [c.71.1.2] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD A:146 -- 359
    8e-24  26%  2aznA1 [c.71.1.2] PUTATIVE 5-AMINO-6-(5-PHOSPHORIBOSYLAMINO)URACIL
    7e-21  27%  1wwrA1 [c.97.1.2] TRNA ADENOSINE DEAMINASE TADA A:1 -- 151
    4e-18  34%  1tiyA  [c.97.1.2] GUANINE DEAMINASE
    1e-17  19%  2g84A1 [c.97.1.2] CYTIDINE AND DEOXYCYTIDYLATE DEAMINASE ZINC- A:1
    4e-17  11%  1j3iA  [c.71.1.1] BIFUNCTIONAL DIHYDROFOLATE REDUCTASE-THYMIDYLATE
    8e-17  14%  1dioB  [c.51.3.1] PROTEIN (DIOL DEHYDRATASE)
    4e-16  22%  2hxvA1 [c.71.1.2] DIAMINOHYDROXYPHOSPHORIBOSYLAMINOPYRIMIDINE A:148
    6e-16  11%  1af2A2 [c.97.1.1] CYTIDINE DEAMINASE A:151 -- 294
    7e-16  24%  1ox7A  [c.97.1.2] CYTOSINE DEAMINASE
    3e-15  35%  1vq2A  [c.97.1.2] DEOXYCYTIDYLATE DEAMINASE
    3e-15  14%  1jtkA  [c.97.1.1] CYTIDINE DEAMINASE
    3e-08  16%  1ai9A  [c.71.1.1] DIHYDROFOLATE REDUCTASE
    6e-07  20%  1qzfA1 [c.71.1.1] BIFUNCTIONAL DIHYDROFOLATE REDUCTASE-THYMIDYLATE
    2e-05  12%  1vdrA  [c.71.1.1] DIHYDROFOLATE REDUCTASE
    0.001  21%  1af2A1 [c.97.1.1] CYTIDINE DEAMINASE A:1 -- 150
:351

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MELALNLAKARHGLTGINPSVGCVIVKNNKILSIGQTGFKGTPHAEFNAIKNSHENIEGSKMYVTLEPCS
2b3zA1          ----------------------------------------------------------------------
2aznA1          ----------------------------------------------------------------------
1wwrA1          LKVALREAKR--AFEKGEVPVGAIIVKEGEIISKAHNSVDPTAHAEMLAIKENTKYLEGCELYVTLEPC-
1tiyA           LKRAVTLA--CEGVAGIGGPFGAVIVKDGAIIAEGQTSNDPTAHAEVTAIRKGAYQLDDCILYTSCEPC-
2g84A1          MGYVLELVRA--NIAADGGPFAAAVFDSGLLIAAGVPGRCSAAHAEILALSLSADGLPACELVTSAEPC-
1j3iA           ----------------------------------------------------------------------
1dioB           ----------------------------------------------------------------------
2hxvA1          ----------------------------------------------------------------------
1af2A2          SQAAIAAAN-RSHMPYSKSPSGVALECKDGRIFSGNAAFNPTLPPLQGALILKGYDYPDIQRAVLAEKAD
1ox7A           -DIAYEEAALGYKEGGV-P-IGGCLIKDGSVLGRGHQKGSATLHGEISTLENEGKVYKDTTLYTTLSPC-
1vq2A           LQIAYLVSQES---KCCSWKVGAVIEKNGRIISTGYNGSKNEIHAELNAILFAAENIEGATMYVTLSPC-
1jtkA           ITEALKARDMAYAPYS-KFQVGAALLTKDGKVYRGNAAYSMCNCAERTALTEFQMLAVAADTPGPVSPC-
1ai9A           ----------------------------------------------------------------------
1qzfA1          ----------------------------------------------------------------------
1vdrA           ----------------------------------------------------------------------
1af2A1          -----------------NFNVGAIARGVSGTWYFGANMEFITVHAEQSAISHAWLSGALAAITVNYTPCG


                         .         .         *         .         .         .         .:140
query           HYGKTPPCTXXXXXXXXXEVVYGVEDIDKKVKGKTLNILKSKNILVKKDLLKKQINKFYAPYFFNRKKNL
2b3zA1          ----------------------------------------------------------------------
2aznA1          -------------------------------------------------------------------EKK
1wwrA1          -----IMCSYALVLSRIEKVIFSALDKKHGGVVSVFNILDEPTLNHRVKWEYEEASELLSEFFKKLRNNI
1tiyA           -----PXCLGAIYWARPKAVFYAAEHTDAAEAG-------------------------------------
2g84A1          -----VMCFGAVIWSGVRSLVCAARSDDVEAIGNWMGGLEARGITVTTGLLRDAACALLREYN--ACNGV
1j3iA           ------------------------------------------------QVCDVFDIYAICACCKVESKNE
1dioB           ------------------EVIIAVGPAFGLAQTVNIVGIPHKSILREVIAGIEEEGI---KARVIRCFKS
2hxvA1          ----------------------------------------------------------------------
1af2A2          APLIWDATSATLKALGCHSIDRVL----------------------------------------------
1ox7A           -----DXCTGAIIXYGIPRCVVG-ENV--NFKSKGEKYLQTRGHEV-VVVDDERCKKIXKQFIDER----
1vq2A           -----PDCAKAIAQSGIKKLVYC--ETYDKNKPGWDDILRNAGIEVFNVPKKNKLNW----ENINEFCG-
1jtkA           -----GACRQVISELCTKDVIVVLTNLQGQIKEMTVEELLPGAFSSE-----------------------
1ai9A           ----------------------------------------------------------------------
1qzfA1          ----------------------------------------------------------------------
1vdrA           ----------------------------------------------------------------------
1af2A1          H------CRQFMNELNSGLDLRI-----------------------------------------------


                         +         .         .         .         .         *         .:210
query           PYVTGKIAISKNNLIYSKDTKRISDIHTDRFTHFLRYKNDSLMISSKTLNKDDPKLNCRLEGLSKFSPKR
2b3zA1          PYVTLKAAASLDGKIATSTSKWITSEAARQDAQQYRKTHQSILVGVGTVKADNPSLTCRLPNVTK-QPVR
2aznA1          PYIISNVGXTLDGKLATINNDRISCEEDLIRVHKIRANVDGIXVGIGTVLKDDPRLTVHKIKSDR-NPVR
1wwrA1          ----------------------------------------------------------------------
1tiyA           ----------------------------------------------------------------------
2g84A1          IYN-------------------------------------------------------------------
1j3iA           GKKNEVFNNYTFRGLGNKG--VLPWKCNSLDMKYFCAVTTYVNESKYEKLKYKRCKYLNKETKKL--QNV
1dioB           SDVAAVEGNSGSGISIGIQSKGTTVIH---QQGLPPLSNLELFPQAPLLTLETYRQIGRYAKRESPQPVP
2hxvA1          PFVALKYASTLDGKIADHRGDKWITDKLRFKVHEXRNIYSAVLVGAGTVLKDNPQLTCRLKEGRN--PVR
1af2A2          ----------------------------------------------------------------------
1ox7A           ----------------------------------------------------------------------
1vq2A           ----------------------------------------------------------------------
1jtkA           ----------------------------------------------------------------------
1ai9A           PNVAIIVAALKPALGIGYKGKEIRYFKDVTTRTTKPNTRNAVIMGRKTW-ESIPQKFRPLPD-----RLN
1qzfA1          -------------------------------------KNVSIVVAASVLSSGNGQLPWSISEDLKF-FSK
1vdrA           --LVSVAALAENRVIRDGELPWPSIPADKKQYRSRI-ADDPVVLGRTTFESMRDDLPGS---------AQ
1af2A1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           IILDRNLEIKKNSYIFKTANKDNTIIFYYNAKAEVKLMLKKKGITLIKSKLNKNSFDIKSILMKLYVLGC
2b3zA1          VILDTVLSIPEDAKVICDQIAPTWIFTTARADEEKKKRLSAFGVNIF--TLETERIQIPDVLKILAEEGI
2aznA1          IVVDSKLRVPLNARVLNKD--AKTIIATTEDTNEEKEILEDXGVEVVKCGRGK--VDLKKLXDILYDKGI
1wwrA1          ----------------------------------------------------------------------
1tiyA           ----------------------------------------------------------------------
2g84A1          ----------------------------------------------------------------------
1j3iA           VVMGRTSWESIPKKFKPLSNRINVIL-----SRTLKKEDFDEDVYIIN--------KVEDLIVLLGKLNY
1dioB           TLNDQMARPKYQAKSAILHIK-ETKYVVTGKNPQEL----------------------------------
2hxvA1          VILDRKGVLSGKVFRVFEENARVIVFTESEEAEYPPHVEKALSD-----------CSVESILRNLYERDI
1af2A2          ----------------------------------------------------------------------
1ox7A           ----------------------------------------------------------------------
1vq2A           ----------------------------------------------------------------------
1jtkA           ----------------------------------------------------------------------
1ai9A           IILSRSY----------ENEIIDDNIIHASSIESSLNLVS----------------------------DV
1qzfA1          ITNNKCDSNKKNALIMGRKTWDSIGRPLKNRIIVVISSSLPQDEADPNVVVFRNLEDSIENLMNDD--SI
1vdrA           IVMSRSE---------RSFSVDTAHRAA----------------------------SVEEAVDIAASLDA
1af2A1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RNLLVEGGNDLSKHIIKKKLFNEFYLYKCSKSLSKLVNHKEFGxxxxxxxxxxxxxxxxxxxxxxxxxxx
2b3zA1          MSVYVEGGSAVHGSFVKEGCFQEIIFYFAPKLI-------------------------------------
2aznA1          KSILLEGGGTLNWGXFKEGLVDEVSVY-------------------------------------------
1wwrA1          ----------------------------------------------------------------------
1tiyA           ----------------------------------------------------------------------
2g84A1          ----------------------------------------------------------------------
1j3iA           YKCFIIGGSVVYQEFLEKKLIKKIYFTRINSTYEQIISVSDVY---------------------------
1dioB           ----------------------------------------------------------------------
2hxvA1          DSVLVEGGSKVFSEFL--DHADVVFGF-------------------------------------------
1af2A2          ----------------------------------------------------------------------
1ox7A           ----------------------------------------------------------------------
1vq2A           ----------------------------------------------------------------------
1jtkA           ----------------------------------------------------------------------
1ai9A           ERVFIIGGAEIYNELINNSLVSHLLITEIEHPS-------------------------------------
1qzfA1          ENIFVCGGESIYRDALKDNFVDRIYLTRVALED-------------------------------------
1vdrA           ETAYVIGGAAIYALFQ--PHLDRMVLSRVPGEY-------------------------------------
1af2A1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           x
2b3zA1          -
2aznA1          -
1wwrA1          -
1tiyA           -
2g84A1          -
1j3iA           -
1dioB           -
2hxvA1          -
1af2A2          -
1ox7A           -
1vq2A           -
1jtkA           -
1ai9A           -
1qzfA1          -
1vdrA           -
1af2A1          -