[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for pubi0:AAZ21934.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1gz0A1.bssp"
#ERROR : Can't open dsspfile "1v2xA.bssp"
#ERROR : Can't open dsspfile "1j85A.bssp"
#ERROR : Can't open dsspfile "1ipaA1.bssp"
#ERROR : Can't open dsspfile "1gqiA2.bssp"
#ERROR : Can't open dsspfile "1z67A1.bssp"
#ERROR : Can't open dsspfile "1gz0A2.bssp"
#ERROR : Can't open dsspfile "1vhkA2.bssp"

## Summary of PDB Search
:247
    7e-36  29%  1gz0A1 [c.116.1.1] HYPOTHETICAL TRNA/RRNA METHYLTRANSFERASE YJFH
    1e-34  25%  1v2xA  [c.116.1.1] TRNA (GM18) METHYLTRANSFERASE
    6e-34  19%  1j85A  [c.116.1.1] YIBK
    2e-30  20%  1ipaA1 [c.116.1.1] RNA 2'-O-RIBOSE METHYLTRANSFERASE A:106 -- 263
    1e-25  14%  1gqiA2 [d.92.2.2] ALPHA-GLUCURONIDASE A:5 -- 151
    2e-20  15%  1z67A1 [a.259.1.1] HYPOTHETICAL PROTEIN S4005 A:3 -- 131
    1e-05  28%  1gz0A2 [d.79.3.3] HYPOTHETICAL TRNA/RRNA METHYLTRANSFERASE YJFH
    2e-04  14%  1vhkA2 [c.116.1.5] HYPOTHETICAL PROTEIN YQEU A:74 -- 253
:247

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDKYTSKDQI
1gz0A1          ----------------------------------------------------------------------
1v2xA           ----------------------------------------------------------------------
1j85A           ----------------------------------------------------------------------
1ipaA1          ----------------------------------------------------------------------
1gqiA2          ----------------------------------------------------------------------
1z67A1          ----------------------------------------------------------------------
1gz0A2          -------IYGIHAVQALLERAPERFQEVFILK------GREDKRLLPLIHVVIQLANRQYLDEKSDGAV-
1vhkA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           MHGGYIAEVEHIDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRSASSFHIDGLIVKERQFPSDSKLM
1gz0A1          ---------------DLPDLIASLDQPFLLILDGVTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATA
1v2xA           -----IEEVLRRRQPDL-----------TVLLENVHKPHNLSAILRTCDAVGVLEAHAVNPT--GGVPTF
1j85A           ----------------------------DIVLYEPEIPQNTGNIIRLCANTGFRLHLIEPLGFTWDDKRL
1ipaA1          ----------------LEEYRPSPDALILVA-VGLEKPGNLGAVLRSADAAGAEAVLVAGGVDLYSPQ-V
1gqiA2          ---GYDMWLRYQPIADQTL----LKTYQ-KQIRHLHVAGD-SPTINAAAAELLSGLLNKPIVARDEKLKD
1z67A1          ----------------VGAFLKGDAGKYQAILSWVEEQGGIQVLLEKLQSGGLGAILSQQRNQSVSGEQL
1gz0A2          -HQGIIARVK------------------------------------------------------------
1vhkA2          -----------------------------YIASGLPKGDKLEWIIQKGTELGAHAPFQAAR---SVVKRW


                         +         .         .         .         .         *         .:210
query           YKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARGEKDFTEIKWEGKNVLLFGSEGFGMREHTGK
1gz0A1          KKVACGAAESVPLIRVTNLARTXRXLQEENIWIVGTAGEADHTLYQSKXTGRLALVXGAEGEGXRRLTRE
1v2xA           NETSGGSHKWVYLRVHPDLHEAFRFLKERGFTVYATALREDRDFREVDYTKPTAVLFGAEKWGVSEEALA
1j85A           RRSGLDYHEFAEIKRHKTFEAFLESEKPKRLFALT--TKGCPAHSQVKFKLGDYLMFGPETRGIPMSNEM
1ipaA1          IRNSTGVVFSLRTLAASESE-VLDWIKQHNLPLVATTPHAEALYWEANLRPPVAIAVGPEHEGLRAAWLE
1gqiA2          YSLVIGTPDNSPLIASLNLGERLQALGAEGYLLEQTRINKRHV----------VIVAANSDVGVLYGS--
1z67A1          -ESALGTVSDLGQKLGVDTSTASSLLAEQLPKIIDLSPQGEVQANNDLLSAGXELLKG------------
1gz0A2          ----------------------------------------------------------------------
1vhkA2          TKIAKEAAEQSYVXDVHSFQQLLQRXQDFDKCVVAYESAFSAIVSSLPKGSSLLIVFGPEG-GLTEAEVE


                         .         .         .         +         .         .         .:280
query           YTDFFVKIDINKDVESLNISNSAAIVFHHLSYLxxxx
1gz0A1          HCDELISIPXAGSVSSLNVSVATGICLFE--------
1v2xA           LADGAIKIPMLGMVQSLNVSVAAAVILF---------
1j85A           PMEQKIRIPMTANSRSMNLSNSVAVTVYEAW------
1ipaA1          AAQTQVRIPMQGQADSLNVSVSAALLLY---------
1gqiA2          -FHLLRLIQTQHALEKLSLSSA---------------
1z67A1          -------------------------------------
1gz0A2          -------------------------------------
1vhkA2          RLTEQDGVTCGLGPRILRTETAPLYALSAISYQ----