[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for pubi0:AAZ21946.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1wikA.bssp"
#ERROR : Can't open dsspfile "1t1vA.bssp"
#ERROR : Can't open dsspfile "1rw1A.bssp"
#ERROR : Can't open dsspfile "1aazA.bssp"
#ERROR : Can't open dsspfile "1i9dA.bssp"
#ERROR : Can't open dsspfile "1wjkA.bssp"
#ERROR : Can't open dsspfile "1kteA.bssp"
#ERROR : Can't open dsspfile "1egoA.bssp"
#ERROR : Can't open dsspfile "1z3eA1.bssp"
#ERROR : Can't open dsspfile "1nm3A1.bssp"
#ERROR : Can't open dsspfile "1jlvA2.bssp"
#ERROR : Can't open dsspfile "1gwcA2.bssp"
#ERROR : Can't open dsspfile "1k0mA2.bssp"
#ERROR : Can't open dsspfile "1h75A.bssp"

## Summary of PDB Search
:110
    1e-17  40%  1wikA  [c.47.1.1] THIOREDOXIN-LIKE PROTEIN 2
    5e-12  17%  1t1vA  [c.47.1.14] SH3 DOMAIN-BINDING GLUTAMIC ACID-RICH PROTEIN-
    1e-11  13%  1rw1A  [c.47.1.12] CONSERVED HYPOTHETICAL PROTEIN YFFB
    4e-10  19%  1aazA  [c.47.1.1] GLUTAREDOXIN
    5e-10  15%  1i9dA  [c.47.1.12] ARSENATE REDUCTASE
    2e-09  15%  1wjkA  [c.47.1.1] C330018D20RIK PROTEIN
    5e-08  24%  1kteA  [c.47.1.1] THIOLTRANSFERASE
    9e-08  11%  1egoA  [c.47.1.1] GLUTAREDOXIN
    9e-07  13%  1z3eA1 [c.47.1.12] REGULATORY PROTEIN SPX A:1 -- 114
    1e-06  25%  1nm3A1 [c.47.1.1] PROTEIN HI0572 A:166 -- 239
    6e-06  14%  1jlvA2 [c.47.1.5] GLUTATHIONE TRANSFERASE GST1-3 A:1 -- 84
    6e-06  16%  1gwcA2 [c.47.1.5] GLUTATHIONE S-TRANSFERASE TSI-1 A:4 -- 86
    1e-05  21%  1k0mA2 [c.47.1.5] CHLORIDE INTRACELLULAR CHANNEL PROTEIN 1 A:6 --
    6e-04  16%  1h75A  [c.47.1.1] GLUTAREDOXIN-LIKE PROTEIN NRDH
:110

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxDSTKNLIQGHIETNEVCLFMKGTPDAPQCGFSMAVSNMLKILEVNYKGINVLESQSLREGIKEFSDWP
1wikA           --SSGSSGLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKTFSNWP
1t1vA           -------------------VYSTSVTSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRTLAGNP
1rw1A           -----------------YVLYGI-----KACDTXKKARTWLDEHKVAYDFHDYKAVGIDREHLRRWCAEH
1aazA           ----------------KVYGYDSNIH---KCVYCDNAKRLLTVKKQPFEFINIMPEKGVFDDERDTQIGL
1i9dA           -------------------IYHN-----PACGTSRNTLEMIRNSGTEPTIILYLENPPSRDELVKLMGIS
1wjkA           ---------------------------KAPCPLCDEAKEVLQPYKDRFILQEVDITLPENSTWYERYKF-
1kteA           --------VNSKIQPGKVVVFI-----KPTCPFCRKTQELLSQLPFKEGLLEFVDTNEIQDYLQQLTGAR
1egoA           -----------------TVIFG-----RSGCPYCVRAKDLAEKLSNERDDVDIRAEGITKEDLQQKAGKP
1z3eA1          ----------------------------PSCTSCRKARAWLEEHEIPFVERNIFSEPLSIDEIKQITEDG
1nm3A1          -----------HQVQESISIFTK-----PGCPFCAKAKQLLHDKGLSFEEIILGHDAT-IVSVRAVSGRT
1jlvA2          ----------------------------PGSAPCRAVQMTAAAVGVELKLTNLMAGEHMKPEFLKINPQH
1gwcA2          ---------------DDLKLLGA-----WPSPFVTRVKLALALKGLSYEDVEEDLYKKSELLLKSNPVHK
1k0mA2          -------------------LFVKAGSDIGNCPFSQRLFMVLWLKGVTFNVTTV-DTKRRTETVQKLCPGG
1h75A           ----------------------------NDCVQCHATKRAMENRGFDFEMINVDRVPEAAEALRA-QGFR


                         .         .         *         .         .         .         .:140
query           TIPQVYIKGEFVGGCDIVKEMYENGELKKVLEDKGINFKx
1wikA           TYPQLYVRGDLVGGLDIVKELKDNGELLPILKGES-----
1t1vA           TPPQIVNGNHYCGDYELFVEAVEQDTLQEFLKL-------
1rw1A           GWQTVLNRAGFRKLDEAQKADLDEAKAIELXLAQPSXIK-
1aazA           TMPQVFAPGSHIGGFDQLREYFK-----------------
1i9dA           VRALLRKNVEPYEQLGLAEDKFTDDQLIDFMLQHPI----
1wjkA           DIPVFHLNGQFLMMHRVNTSKLEK-QLRKLS---------
1kteA           TVPRVFIGKECIGGCTDLESMHKRGELLTRLQQVG-----
1egoA           VETQIFVDQQHIGGYTDFAAWVKE----------------
1z3eA1          TDEIISTRSKVFQKLNVNVESMPLQDLYRLINEHPG----
1nm3A1          TVPQVFIGGKHIGGSDDLEK--------------------
1jlvA2          CIPTLVDNGFALWESRAICTYLA-----------------
1gwcA2          KIPVLIHNGAPVCESMIILQ--------------------
1k0mA2          ELPFLLYGTEVHTDTNKIEEFLE-----------------
1h75A           QLPVVIAGDLSWSGPDMINRLH------------------