[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for pubi0:AAZ21961.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1syyA.bssp"
#ERROR : Can't open dsspfile "1kgnA.bssp"
#ERROR : Can't open dsspfile "1h0nA.bssp"
#ERROR : Can't open dsspfile "1av8A.bssp"
#ERROR : Can't open dsspfile "1fyzC.bssp"
#ERROR : Can't open dsspfile "1t0qB.bssp"
#ERROR : Can't open dsspfile "1za0A1.bssp"

## Summary of PDB Search
:337
    9e-68  30%  1syyA  [a.25.1.2] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE BETA CHAIN
    4e-65  22%  1kgnA  [a.25.1.2] RIBONUCLEOTIDE REDUCTASE PROTEIN R2F
    2e-52  24%  1h0nA  [a.25.1.2] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE
    2e-42  21%  1av8A  [a.25.1.2] RIBONUCLEOTIDE REDUCTASE R2
    1e-30   6%  1fyzC  [a.25.1.2] METHANE MONOOXYGENASE COMPONENT A, BETA CHAIN
    9e-24  12%  1t0qB  [a.25.1.2] TOLUENE, O-XYLENE MONOOXYGENASE OXYGENASE
    4e-07   9%  1za0A1 [a.25.1.2] POSSIBLE ACYL-[ACYL-CARRIER PROTEIN] DESATURASE
:337

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxLLVENPVYKPFRYPWCYDAWLTQQRIHWLPEEVPLGDDVRDWQKNLTQSE
1syyA           ---------------------------LVPIKYKWAWEHYLNGCANNWLPTEIPMGKDIELWKSDLSEDE
1kgnA           --------------------------------DEKDLEVWDRLTGNFWLPEKIPVSNDIQSWNK-MTPQE
1h0nA           -----------------------RRFVVFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWEA-LKPDE
1av8A           --------------------MFFGQPVYDQQKYDIFEKLIEKQLSFFWRPEEVDVSRDRIDYQA-LPEHE
1fyzC           -----------------------------PLRRWHAPYVKDKAEEWRYTDRFLQGYSADGQI-RAMNPTW
1t0qB           -------------------------YKKYCFDSPLKHDDWFRDPDQLVYRTYNLLQDGQESYVQGLTREW
1za0A1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KNLLTQIFRFFTQADVEVQNCYLRHYTTVFKPTEVLMMMTAFASMETVHIAAYSHLLDTIGMPESEYSAF
1syyA           RRVILLNLGFFSTAESLVGNIVLAIFKHVTNP-EARQYLLRQAFEEAVHTHTFLYICESLGLDEKEIDDF
1kgnA           QLATMRVFTGLTLLDTIQGTVGAISLLPDAETMHEEAVYTNIAFMESVHAKSYSNIFMTLASTPQINEAF
1h0nA           RHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEFNAI
1av8A           KHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSYTHIIRNIVDPSVVFDDI
1fyzC           RDEFINRYWGAFLFNEYGLFNAHSQGAREALSDVTRVSLAFWGFDKIDIAQMIQLERGFLAKIVPGFDES
1t0qB           VETLARFYTPARYLFHALQMGSVY-IHQIAPASTITNCATYETADHLRWLTHTAYRTRELANCYPDVGFG
1za0A1          --------HLDTEDIWFAHDYVPFDQGENFAFLGGRDWDPSQSTLPRTITDACEILLILKDNDWGRWTAE


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXXXXQNFDMSSKKDIALTVAVFSAFTEGLQLFASFAILLNFPRHNKMKGMGQIVTWSVRDE
1syyA           QMEITGKVLDPNFRTDSVEGLQEFVKNLVGYYIIMEGIFFYSGFVMILSFHRQNKMIGIGEQYQYILRDE
1kgnA           RWSEENENLQRKAKIIMSYYNGDDPLKKKVASTLLESFLFYSGFYLPMYLSSRAKLTNTADIIRLIIRDE
1h0nA           ETMPCVKKKADWALRWIGDKEATYGERVVAF-AAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDE
1av8A           VTNEQIQKRAEGISSYYDELIEMTSYWHLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIRLIARDE
1fyzC           TAVPKAEWTNGEVYKSARLAVEGLWQEVSVHAVYDALFGQFVRREFFQRLAPRFGDNLTPFFINQAQTYF
1t0qB           KRERDVWENDPAWQGFKALIAWDWGEAFTAINLVTKPAVEEALLQQLGSLAQSEGDTLLGLLAQAQKRDA
1za0A1          EHLHAIALREYLVVTVDPVANEDVRVKYTQVETLVYMAFYERGAVFCRNLAAQIEEPILAGLIDRIARDE


                         .         .         .         +         .         .         .:280
query           TLHCNSMIRLFKEFIHENPEIWTPELKAELYKACRTIIEHEDAFIDLAFEMGPMQGLTAQDVKLYIRFIA
1syyA           TIHLNFGIDLINGIKEENPEIWTPELQQEIVELIKRAVDLEIEYAQDCLPRG-ILGLRASMFIDYVQHIA
1kgnA           SVHGYYIGYKYQQGVKKLSEAEQEEYKAYTFDLMYDLYENEIEYTEDIY---DDLGWTE-DVKRFLRYNA
1h0nA           GLHCDFACLMFKHLVHKPAE-------QRVREIITNAVRIEQEFLTEALPVK-LIGMNCTLMKQYIEFVA
1av8A           ALHLTGTQHMLNLLRSGADDPIAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLNKDILCQYVEYIT
1fyzC           QIAKQGVQDLYYNCLGDDPE-FSDYNRTVMRNWTGKWLEPTIAALRDFMGLF-AKLPAGTTDKEEITASL
1t0qB           ERHRRWSSALVKMALEKEG--NREVLQKWVAKWEPLADKAIEAYCSAL-----PDGENAIV---EAKSAS
1za0A1          VRHEEFFANLVTHCLDYTRDETIAAIAA------------------------------------------


                         .         *         .         .         .         .         +:350
query           NRRLSQLGLEPIYDVDKNPLTWLDSMLNAxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1syyA           DRRLERIGLKPIYHT-KNPFPWM----------------------------------
1kgnA           NKALNNLGYEGLFPTDETKLSSL----------------------------------
1h0nA           DRLMLELGFNKIFRV-ENPFDFME---------------------------------
1av8A           NIRMQAVGLDLPFQTRSNPIPWINTWL------------------------------
1fyzC           YRVVDDWIEDYASRIDKADRDQIVKAVLA----------------------------
1t0qB           RYVRQMMG-------------------------------------------------
1za0A1          ---------------------------------------------------------