[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for pubi0:AAZ22048.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1o89A2.bssp"
#ERROR : Can't open dsspfile "1ztpA1.bssp"
#ERROR : Can't open dsspfile "1o89A1.bssp"
#ERROR : Can't open dsspfile "1kolA1.bssp"
#ERROR : Can't open dsspfile "1yb5A2.bssp"
#ERROR : Can't open dsspfile "1v3tA2.bssp"
#ERROR : Can't open dsspfile "1a71A2.bssp"
#ERROR : Can't open dsspfile "1gu7A1.bssp"
#ERROR : Can't open dsspfile "1lluA2.bssp"
#ERROR : Can't open dsspfile "1pqwA.bssp"
#ERROR : Can't open dsspfile "1v3tA1.bssp"
#ERROR : Can't open dsspfile "1iyzA2.bssp"
#ERROR : Can't open dsspfile "1wkvA1.bssp"
#ERROR : Can't open dsspfile "1e3jA1.bssp"
#ERROR : Can't open dsspfile "1qorA1.bssp"
#ERROR : Can't open dsspfile "1bxzA1.bssp"
#ERROR : Can't open dsspfile "1h2bA2.bssp"
#ERROR : Can't open dsspfile "1vj1A1.bssp"
#ERROR : Can't open dsspfile "1o8cA2.bssp"
#ERROR : Can't open dsspfile "1e3jA2.bssp"
#ERROR : Can't open dsspfile "2oplA1.bssp"
#ERROR : Can't open dsspfile "1a71A1.bssp"
#ERROR : Can't open dsspfile "1gv8A.bssp"
#ERROR : Can't open dsspfile "1f8fA1.bssp"
#ERROR : Can't open dsspfile "1uufA1.bssp"
#ERROR : Can't open dsspfile "1a9xA3.bssp"
#ERROR : Can't open dsspfile "1vj0A1.bssp"
#ERROR : Can't open dsspfile "1piwA2.bssp"
#ERROR : Can't open dsspfile "1iyzA1.bssp"
#ERROR : Can't open dsspfile "1aorA1.bssp"
#ERROR : Can't open dsspfile "1vm6A3.bssp"
#ERROR : Can't open dsspfile "1sb8A.bssp"
#ERROR : Can't open dsspfile "1qycA.bssp"
#ERROR : Can't open dsspfile "2hjsA1.bssp"
#ERROR : Can't open dsspfile "1bxzA2.bssp"
#ERROR : Can't open dsspfile "1c3vA1.bssp"
#ERROR : Can't open dsspfile "1vl0A.bssp"
#ERROR : Can't open dsspfile "1i24A.bssp"
#ERROR : Can't open dsspfile "2a35A1.bssp"
#ERROR : Can't open dsspfile "1k6iA.bssp"
#ERROR : Can't open dsspfile "1xq6A.bssp"
#ERROR : Can't open dsspfile "1a9yA.bssp"
#ERROR : Can't open dsspfile "1ujmA.bssp"
#ERROR : Can't open dsspfile "2c54A1.bssp"
#ERROR : Can't open dsspfile "2b69A1.bssp"
#ERROR : Can't open dsspfile "1tdjA1.bssp"
#ERROR : Can't open dsspfile "1nasA.bssp"
#ERROR : Can't open dsspfile "1a4iA1.bssp"
#ERROR : Can't open dsspfile "1yb1A.bssp"
#ERROR : Can't open dsspfile "2ib0A1.bssp"
#ERROR : Can't open dsspfile "1b8pA1.bssp"
#ERROR : Can't open dsspfile "1eq2A.bssp"
#ERROR : Can't open dsspfile "1p9oA.bssp"
#ERROR : Can't open dsspfile "1jr2A.bssp"
#ERROR : Can't open dsspfile "1db3A.bssp"
#ERROR : Can't open dsspfile "2bkaA1.bssp"
#ERROR : Can't open dsspfile "1ae1A.bssp"
#ERROR : Can't open dsspfile "1xg5A.bssp"
#ERROR : Can't open dsspfile "1eyzA2.bssp"
#ERROR : Can't open dsspfile "1kolA2.bssp"
#ERROR : Can't open dsspfile "1b6rA2.bssp"
#ERROR : Can't open dsspfile "1zemA1.bssp"
#ERROR : Can't open dsspfile "1snyA.bssp"
#ERROR : Can't open dsspfile "1y81A1.bssp"
#ERROR : Can't open dsspfile "1bxkA.bssp"

## Summary of PDB Search
:333
    5e-31  43%  1o89A2 [c.2.1.1] YHDH A:116 -- 292
    5e-24   5%  1ztpA1 [d.86.1.2] BASOPHILIC LEUKEMIA EXPRESSED PROTEIN BLES03 A:17
    5e-22  43%  1o89A1 [b.35.1.2] YHDH A:1 -- 115 A:293 -- 323
    7e-21  13%  1kolA1 [b.35.1.2] FORMALDEHYDE DEHYDROGENASE A:2 -- 160 A:356 --
    3e-20  21%  1yb5A2 [c.2.1.1] QUINONE OXIDOREDUCTASE A:121 -- 294
    3e-19  27%  1v3tA2 [c.2.1.1] LEUKOTRIENE B4 12- A:113 -- 294
    9e-19  13%  1a71A2 [c.2.1.1] LIVER ALCOHOL DEHYDROGENASE A:164 -- 339
    3e-17  19%  1gu7A1 [b.35.1.2] 2,4-DIENOYL-COA REDUCTASE A:23 -- 160 A:350 --
    1e-16  22%  1lluA2 [c.2.1.1] ALCOHOL DEHYDROGENASE A:144 -- 309
    4e-16  19%  1pqwA  [c.2.1.1] POLYKETIDE SYNTHASE
    7e-16  17%  1v3tA1 [b.35.1.2] LEUKOTRIENE B4 12- A:1 -- 112 A:295 -- 329
    1e-15  24%  1iyzA2 [c.2.1.1] QUINONE OXIDOREDUCTASE A:99 -- 269
    3e-15  12%  1wkvA1 [c.79.1.1] CYSTEINE SYNTHASE A:2 -- 383
    5e-15  19%  1e3jA1 [b.35.1.2] NADP(H)-DEPENDENT KETOSE REDUCTASE A:4 -- 142
    8e-15  17%  1qorA1 [b.35.1.2] QUINONE OXIDOREDUCTASE A:2 -- 112 A:292 -- 327
    1e-14  22%  1bxzA1 [b.35.1.2] NADP-DEPENDENT ALCOHOL DEHYDROGENASE A:1 -- 139
    1e-14  23%  1h2bA2 [c.2.1.1] ALCOHOL DEHYDROGENASE A:155 -- 326
    2e-14  22%  1vj1A1 [b.35.1.2] PUTATIVE NADPH-DEPENDENT OXIDOREDUCTASE A:-1 --
    2e-14  49%  1o8cA2 [c.2.1.1] YHDH A:116 -- 192
    1e-13  11%  1e3jA2 [c.2.1.1] NADP(H)-DEPENDENT KETOSE REDUCTASE A:143 -- 312
    2e-13  14%  2oplA1 [d.227.1.1] HYPOTHETICAL PROTEIN A:4 -- 185
    5e-13  22%  1a71A1 [b.35.1.2] LIVER ALCOHOL DEHYDROGENASE A:1 -- 163 A:340 --
    2e-12   7%  1gv8A  [c.94.1.2] OVOTRANSFERRIN
    7e-12  20%  1f8fA1 [b.35.1.2] BENZYL ALCOHOL DEHYDROGENASE A:4 -- 162 A:337 --
    6e-11  20%  1uufA1 [b.35.1.2] ZINC-TYPE ALCOHOL DEHYDROGENASE-LIKE PROTEIN A:3
    5e-10  18%  1a9xA3 [c.30.1.1] CARBAMOYL PHOSPHATE SYNTHETASE (LARGE CHAIN) A:1
    7e-10  16%  1vj0A1 [b.35.1.2] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING A:2 -- 155
    1e-09  19%  1piwA2 [c.2.1.1] HYPOTHETICAL ZINC-TYPE ALCOHOL DEHYDROGENASE-
    2e-08  26%  1iyzA1 [b.35.1.2] QUINONE OXIDOREDUCTASE A:1 -- 98 A:270 -- 302
    5e-07  15%  1aorA1 [a.110.1.1] ALDEHYDE FERREDOXIN OXIDOREDUCTASE A:211 -- 605
    9e-07  15%  1vm6A3 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:1 -- 96 A:183 --
    1e-06  37%  1sb8A  [c.2.1.2] WBPP
    5e-06  11%  1qycA  [c.2.1.2] PHENYLCOUMARAN BENZYLIC ETHER REDUCTASE PT1
    6e-06  19%  2hjsA1 [c.2.1.3] USG-1 PROTEIN HOMOLOG A:3 -- 129 A:320 -- 336
    7e-06  20%  1bxzA2 [c.2.1.1] NADP-DEPENDENT ALCOHOL DEHYDROGENASE A:140 -- 313
    1e-05  15%  1c3vA1 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:501 -- 605 A:715
    3e-05  23%  1vl0A  [c.2.1.2] DTDP-4-DEHYDRORHAMNOSE REDUCTASE, RFBD ORTHOLOG
    3e-05  26%  1i24A  [c.2.1.2] SULFOLIPID BIOSYNTHESIS PROTEIN SQD1
    3e-05  23%  2a35A1 [c.2.1.2] HYPOTHETICAL PROTEIN PA4017 A:4 -- 215
    4e-05  16%  1k6iA  [c.2.1.2] NMRA
    4e-05  30%  1xq6A  [c.2.1.2] UNKNOWN PROTEIN
    5e-05  34%  1a9yA  [c.2.1.2] UDP-GALACTOSE 4-EPIMERASE
    6e-05  23%  1ujmA  [c.2.1.2] ALDEHYDE REDUCTASE II
    1e-04  30%  2c54A1 [c.2.1.2] GDP-MANNOSE-3', 5'-EPIMERASE A:13 -- 374
    2e-04  31%  2b69A1 [c.2.1.2] UDP-GLUCURONATE DECARBOXYLASE 1 A:4 -- 315
    2e-04  23%  1tdjA1 [c.79.1.1] BIOSYNTHETIC THREONINE DEAMINASE A:5 -- 335
    2e-04  19%  1nasA  [c.2.1.2] SEPIAPTERIN REDUCTASE
    2e-04  15%  1a4iA1 [c.2.1.7] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:127 --
    3e-04  26%  1yb1A  [c.2.1.2] 17-BETA-HYDROXYSTEROID DEHYDROGENASE TYPE XI
    3e-04   3%  2ib0A1 [a.25.1.9] CONSERVED HYPOTHETICAL ALANINE RICH PROTEIN A:17
    4e-04  22%  1b8pA1 [c.2.1.5] PROTEIN (MALATE DEHYDROGENASE) A:3 -- 158
    4e-04  29%  1eq2A  [c.2.1.2] ADP-L-GLYCERO-D-MANNOHEPTOSE 6-EPIMERASE
    4e-04  16%  1p9oA  [c.72.3.1] PHOSPHOPANTOTHENOYLCYSTEINE SYNTHETASE
    5e-04  21%  1jr2A  [c.113.1.1] UROPORPHYRINOGEN-III SYNTHASE
    5e-04  37%  1db3A  [c.2.1.2] GDP-MANNOSE 4,6-DEHYDRATASE
    6e-04  32%  2bkaA1 [c.2.1.2] TAT-INTERACTING PROTEIN TIP30 A:5 -- 236
    7e-04  41%  1ae1A  [c.2.1.2] TROPINONE REDUCTASE-I
    7e-04  36%  1xg5A  [c.2.1.2] ARPG836
    8e-04  18%  1eyzA2 [c.30.1.1] PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2 A:2
    8e-04  16%  1kolA2 [c.2.1.1] FORMALDEHYDE DEHYDROGENASE A:161 -- 355
    9e-04  21%  1b6rA2 [c.30.1.1] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE
    9e-04  26%  1zemA1 [c.2.1.2] XYLITOL DEHYDROGENASE A:3 -- 262
    0.001  23%  1snyA  [c.2.1.2] SNIFFER CG10964-PA
    0.001  22%  1y81A1 [c.2.1.8] CONSERVED HYPOTHETICAL PROTEIN A:6 -- 121
    0.001  30%  1bxkA  [c.2.1.2] PROTEIN (DTDP-GLUCOSE 4,6-DEHYDRATASE)
:333

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSDNFKALVVNQESENFTREVKSIDKSFLKHGDVLVQVDYSDLNYKDALILNNGAKLVKEFPHIPGIDFA
1o89A2          ----------------------------------------------------------------------
1ztpA1          -------------------------------------------------------------RTTPATELD
1o89A1          --------------------VQTLDESRLPEGDVTVDVHWSSLNYKDALAITGKGKIIRNFPMIPGIDFA
1kolA1          -----RGVVYLGEVQKIDYPKMQDPRGKKIEHGVILKVVSTNICGSDQHMVRGRTTA--QVGLVLGHEIT
1yb5A2          ----------------------------------------------------------------------
1v3tA2          ----------------------------------------------------------------------
1a71A2          ----------------------------------------------------------------------
1gu7A1          -----QAVLYTQPKDVLFTQSFEIDDDNLAPNEVIVKTLGSPVNPSDINQIQGTGFGTTEPAAPCGNEGL
1lluA2          ----------------------------------------------------------------------
1pqwA           ----------------------------------------------------------------------
1v3tA1          MVKA-KSWTLKKHFQGKPTELKTVELPPLKNGEVLLEALFLSVDPYMRIASKRLKE----GAVMMGQQVA
1iyzA2          ----------------------------------------------------------------------
1wkvA1          -------------------------------GFSYLENAREVLRSGEARCLGNPRSEPEYVKALYVIGHT
1e3jA1          --DNLSAVLYKQN----DLRLEQRPIPEPKEDEVLLQMAYVGICGSDVHYYEHGADFIVKDPMVIGHEAS
1qorA1          -----TRIEFHKHGGPEVLQAVEFTPADPAENEIQVENKAIGINFIDTYIRS-GLYPPPSLPSGLGTEAA
1bxzA1          -----KGFAML---SIGKVGWIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAIGER-HNMILGHEAV
1h2bA2          ----------------------------------------------------------------------
1vj1A1          ----------------------------LNEGQVQVRTLYLSVDPYXRCKXNEDTGTDYLAPWQLAQVAI
1o8cA2          ----------------------------------------------------------------------
1e3jA2          ----------------------------------------------------------------------
2oplA1          ------------------------------------------VNGVNVDQLXATIEQIKAKPEIAQFKFR
1a71A1          -----KAAVLWEEKKPF--SIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSG--TLVTPLPVIAGHEAA
1gv8A           --------------------YYAVAVVKKGTDFMIKDLRGKTSCHTGLGRSAG------WNIPIGTLIHR
1f8fA1          -----IAAVTPCKGADF--ELQALKIRQPQGDEVLVKVVATGMCHTDLIVRD--QKYPVPLPAVLGHEGS
1uufA1          -----KAVGAYSAKQPL--EPMDITRREPGPNDVKIEIAYCGVCHSDLHQ-VRSEWAGTVYPCVPGHEIV
1a9xA3          ----------------------------------------------------------------------
1vj0A1          MGLKAHAMVLEKFNQPL--VYKEFEISDIPRGSILVEILSAGVCGSDVHMF-RGEDPRVPLPIILGHEGA
1piwA2          ----------------------------------------------------------------------
1iyzA1          -----KAWVLKRLGGPL--ELVDLPEPEAEEGEVVLRVEAVGLNFADHLMRLGAYLTRLHPPFIPGMEVV
1aorA1          ----------------------------------------------------------------------
1vm6A3          ----------------------------------------------------------------------
1sb8A           ----------------------------------------------------------------------
1qycA           ----------------------------------------------------------------------
2hjsA1          ----------------------------------------------------------------------
1bxzA2          ----------------------------------------------------------------------
1c3vA1          ----------------------------------------------------------------------
1vl0A           ----------------------------------------------------------------------
1i24A           ----------------------------------------------------------------------
2a35A1          ----------------------------------------------------------------------
1k6iA           ----------------------------------------------------------------------
1xq6A           ----------------------------------------------------------------------
1a9yA           ----------------------------------------------------------------------
1ujmA           ----------------------------------------------------------------------
2c54A1          ----------------------------------------------------------------------
2b69A1          ----------------------------------------------------------------------
1tdjA1          ----------------------------------------------------------------------
1nasA           ----------------------------------------------------------------------
1a4iA1          ----------------------------------------------------------------------
1yb1A           ----------------------------------------------------------------------
2ib0A1          ----------------------------------------------------------------------
1b8pA1          ----------------------------------------------------------------------
1eq2A           ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
1jr2A           ----------------------------------------------------------------------
1db3A           ----------------------------------------------------------------------
2bkaA1          ----------------------------------------------------------------------
1ae1A           ----------------------------------------------------------------------
1xg5A           ----------------------------------------------------------------------
1eyzA2          ----------------------------------------------------------------------
1kolA2          ----------------------------------------------------------------------
1b6rA2          ----------------------------------------------------------------------
1zemA1          ----------------------------------------------------------------------
1snyA           ----------------------------------------------------------------------
1y81A1          ----------------------------------------------------------------------
1bxkA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GTVLESDNSKFIKGDEVILTGWRVGEIYFGGYSQFAKVNGDYLVKKPKDISSKQAMILGTAGLTALLCSF
1o89A2          -------------------------------------------------LDARKAMIIGTAGFTAMLCVM
1ztpA1          AWL-----AKYPPSQVTRYGDPGSPNSEPVGWIAVYGQGYSPNSGDVQGLQAAWEALQTSGRPI---TPG
1o89A1          GTVRTSEDPRFHAGQEVLLTGWGVGENHWGGLAEQARVKGDWLVAMPQGQAAKEISLSEAPNFAEAIINN
1kolA1          GEVIERDVENLQIGDLVSVPGYVDMGDWTGGQAELVPYADFNLLKLPDRDKAMEKINIAEVVGVQV---I
1yb5A2          -------------------------------------------------LDFKQGAAIGIPYFTAY---R
1v3tA2          ----------------------------------------------PLSLA---LGTIGMPGLTAY---F
1a71A2          -----------------------------------------------------KVCLIGCGFSTGY---G
1gu7A1          FEVIKVNVSSLEAGDWVIPSHV-----NFGTWRTHALGNDDDFIKLPNPAQ--SKANGKPNGLTDAKSIE
1lluA2          -------------------------------------------------VEFAEIAPILCAGVTVYKGLK
1pqwA           -----------------------------------------------------EAATFGVAYLTAW---H
1v3tA1          R-VVESKNSAFPAGSIVLAQSG------WTTHFISDGKGLEKLLTEWPDKKIQYHEHVTKGFENMP---A
1iyzA2          --------------------------------------------------SPEEAAAFPVSFLTAY---L
1wkvA1          LEELG-VFDISVPGEMVFPSPLDFFERGKPTPLVRSRLQLPNGVRVWLKLEWYNPF---SLSVKDRPAVE
1e3jA1          GTVVKKNVKHLKKGDRVAVETFCATPPDDGNLARYYVHAADFCHKLPDNCNVKQLVTHSFKLEQTV---D
1qorA1          GIVSKSGVKHIKAGDRVVYAQSA-----LGAYSSVHNIIADKAAILPAAIKVDVAEQQKYPLKDAQRAHE
1bxzA1          GEVVESEVKDFKPGDRVVLAGWKFSNVKDGVFGEFFHVNDMNLAHLPKEVDPSKLVTHVFRGFDNIEKAF
1h2bA2          ------------------------------------------------REKLVEMAPLADAGITAY---R
1vj1A1          GIVEESKHQKLAKGDFVT--------SFYWPWQTKAILDGNGLEKVDPQLVDGLVKETVAKGLENX----
1o8cA2          -------------------------------------------------LDARKAMIIGTAGFTAMLCVM
1e3jA2          -----------------------------------------------------EEGALLEPLSVGV---H
2oplA1          ATNQWXGG-----THNQATIKDFYGAXAEDDTRKPXVFDLDEPPGENRGANPVEYLLVALSGCLTTSLVA
1a71A1          GIVESEGVTTVRPGDKVIPLWT-----PQCGKCRVCKHPEGNFCLKNDLSMPRGTMQDGTSRFTC-----
1gv8A           GDWEGIESGSVEQAVAKFF-SASC-----VPGATTEQKLCRQCKGDAKTKCLRNAPYSGYSGAFQCLKDG
1f8fA1          GIIEAPNVTELQVGDHVVLSYGYCGKCTQSSFATYALSRENNTVKVTKDFPFDQLVKFYAFDEIN---QA
1uufA1          GRVVADQVEKYAPGDLVGVGCIVDPGHTLGGYSQQIVVHERYVLRIRVADIEMIRADQINEAYERMLRG-
1a9xA3          ----------------------------------------------------------------------
1vj0A1          GRVVEGEKRDLNGELLKPGDLIVWNRGITCGECYWCKVSKEPYLCPNRKVYGINRGCSEYPHLRGCYSSH
1piwA2          ----------------------------------------------------------------------
1iyzA1          GVV---------EGRRYALVPQ-------GGLAERVAVPKGALLPLP-----------------------
1aorA1          ----------------------------------FMLVVREKVNKLRNDPVAGGGLPYGTAVLVNII---
1vm6A3          ----------------------------------------------------------------------
1sb8A           ----------------------------------------------------------------------
1qycA           ----------------------------------------------------------------------
2hjsA1          ----------------------------------------------------------------------
1bxzA2          -------------------------------------------------IPLEAAVMIPDMMTTG----F
1c3vA1          ----------------------------------------------------------------------
1vl0A           ----------------------------------------------------------------------
1i24A           ----------------------------------------------------------------------
2a35A1          ----------------------------------------------------------------------
1k6iA           ----------------------------------------------------------------------
1xq6A           ----------------------------------------------------------------------
1a9yA           ----------------------------------------------------------------------
1ujmA           ----------------------------------------------------------------------
2c54A1          ----------------------------------------------------------------------
2b69A1          ----------------------------------------------------------------------
1tdjA1          ----------------------------------------------------------------------
1nasA           ----------------------------------------------------------------------
1a4iA1          -------------------------------------------------------------PCTPKGCLE
1yb1A           ----------------------------------------------------------------------
2ib0A1          ----------------------------------------------------------------------
1b8pA1          ----------------------------------------------------------------------
1eq2A           ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
1jr2A           ------------------------------------------LLKDAKEDDCGQDPELGLYGLEATLIPV
1db3A           ----------------------------------------------------------------------
2bkaA1          ----------------------------------------------------------------------
1ae1A           ----------------------------------------------------------------------
1xg5A           ----------------------------------------------------------------------
1eyzA2          ----------------------------------------------------------------------
1kolA2          ----------------------------------------------------RDLTCLSDILPTGY---H
1b6rA2          ----------------------------------------------------------------------
1zemA1          ----------------------------------------------------------------------
1snyA           ----------------------------------------------------------------------
1y81A1          ----------------------------------------------------------------------
1bxkA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYDVTAVTGKAENEKYLRSLGAKNIINKADLDK
1o89A2          ALE-DAGVRPQDGE--IVVTGASGGVGSTAVALLHKLGYQVVAVSGRESTHEYLKSLGASRVLPRDEFAE
1ztpA1          TLRQLAITHHVLSGKWLXHLAPGFKLDHAWAGIARAVVEGRLQVKVSPRAKEGGRQVICVYTDDFTDRLG
1o89A1          QIQ-------GRTL--------------------------------------------------------
1kolA1          SLD---------DAPRGYGEFDAGVPKKFVIDPHKTFS--------------------------------
1yb5A2          ALIHSACVKAGESV---LVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNK
1v3tA2          GLLEVCGVKGGETV---LVSAAAGAVGSVVGQIAKLKGCKVVGAAGSDEKIAYLKQIGFDAAFNYKTLEE
1a71A2          SAVKVAKVTQGSTC---AVFGLGGAGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATECVNPQDYKK
1gu7A1          TLYDG--TKPLHEL--YQDGVANSKDGKQLI---------------------------------------
1lluA2          QTNARPG-------QWVAISGI-GGLGHVAVQYARAMGLHVAAIDIDDAKLELARKLGASLTVNARQEDP
1pqwA           SLCEVGRLSPGERV---LIHSATGGVGMAAVSIAKMIGARIYTTAGSDAKREMLSRLGVEYVGDSRSVDE
1v3tA1          AFIEMLNGANLGKA--------------------------------------------------------
1iyzA2          ALK-RAQARPGEKV---LVQAAAGALGTAAVQVARAMGLRVLAAASRPEKLALPLALGAE---EAATYAE
1wkvA1          IISRLSRRVEKGSL---VADATSSNFGVALSAVARLYGYRARVYAAEEFGKLLPRLLGAQVIVDPEAPS-
1e3jA1          AFE-AARKKADNT---IKVMISC-----------------------------------------------
1qorA1          ILESR--ATQGSSL--------------------------------------------------------
1bxzA1          LMKDKP----KDLIKPVVILA-------------------------------------------------
1h2bA2          AVKKAARTLYPGAY--VAIVGV-GGLGHIAVQLLKVMTATVIALDVKEEKLKLAERLGADHVVDRDPVKQ
1vj1A1          ----------GVAF---QSXXTGGNVGKQIVCISEDSS--------------------------------
1o8cA2          AL-EDAGVRPQDGE--IVVTGASGGVGSTAVALLHKLGYQVVAVSGRESTHEYLKSLGA-----------
1e3jA2          ACRR-----AGVQLGTTVLVIGAGPIGLVSVLAAKAYGAFVVCTARSPRRLEVAKNCGADVTLVVDPAKE
2oplA1          HAAAR-----GIALRGSRYEGDIDLRGFLGLSEEVPVGYREIRVF-------------------------
1a71A1          ----------------------------------------------------------------------
1gv8A           ------KGDVAFVKHTTVQENAPEEKDEYELLCLDGTRQPVDS---------------------------
1f8fA1          AIDSRK----GITLKPIIKIA-------------------------------------------------
1uufA1          DVKYR-----------------------------------------------------------------
1a9xA3          ----------------ILILGA-GPIVIGQACEFDYSGAQACKALREEGYRVINNSNPATIMTDPEMADA
1vj0A1          IVLDPETDVL--KVSEKITHRLPLKEANKAL---------------------------------------
1piwA2          -----------------------GGIGSMGTLISKAMGAETYVISRSSRKREDAMKMGADHYIATLE-EG
1iyzA1          ----------------------------------------------------------------------
1aorA1          ---NENGLYPVKNFQTGVYPYAYEQSGEAMAAKYLVRNKPC-----------------------------
1vm6A3          ----------------YGIVGYSGRMGQEIQKVFSEKGHELVLKVDVNGVEELDSPDVVIDFSSPEALPK
1sb8A           ----RKELPAQPKV--WLITGVAGFIGSNLLETLLKLDQKVVGLTGHQRNLDEVRSLSEKQWSNFKFIQG
1qycA           --------------SRILLIGATGYIGRHVAKASLDLGHPTFLLVRESTASSNSEKAQLLESFKASG---
2hjsA1          --------------LNVAVVGATGSVGEALVGLLDERDFPLHRLASAESAGQRXGFAESSLRVGDVDS--
1bxzA2          HGAELADIELGATV---AVLGI-GPVGLMAVAGALRGAGRIIAVGSRPVCVDAAKYYGATDIVNYKDGPI
1c3vA1          ----------------VGVLGAKGKVGTTMVRAVAAADDLTLSAGDPLSLLTDGNTEVVIDFTHPDVVMG
1vl0A           ----------------ILITGANGQLGREIQKQLKGKNVEVIPITNVLAVNKFFNEKKPNVVINCAAHTA
1i24A           --------------SRVMVIGGDGYCGWATALHLSKKNYEVCIVRRLFDHQLGLESLTPIASIHDRISRW
2a35A1          --------------KRVLLAGATGLTGEHLLDRILSEPTLAKVI--------------------------
1k6iA           -----------QQKKTIAVVNATGRQAASLIRVAAAVGHHVRAQVHSLKGLIAEELQAIPNV--------
1xq6A           ----------------VLVTGASGRTGQIVYKKLKE-GSDKFVAKGLVRSAQGKEKIGGEADVFIGDITD
1a9yA           ----------------VLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSV----------------
1ujmA           --------------SLVLVTGANGFVASHVVEQLLEHGYKVRGTARSASKLANLQKRWDAKYPGRFETAV
2c54A1          --------------LKISITGAGGFIASHIARRLKHEGHYV-----------------------------
2b69A1          --------------KRILITGGAGFVGSHLTDKLXXDGHEVTVVTGRKRNVEHWIGHENFELINHDVVEP
1tdjA1          -------AGLTEEQKAHGVITASAGNHAQGVFSSARLGVKALIVMPTDIKVDAVRGFGGEVLLHGANFD-
1nasA           --------------AVCVLTGASRGFGRALAPQLARLLSPGSVMLVSARSESMLRQLKEELGAQQPDLKV
1a4iA1          LIKETGVPI---AGRHAVVVGRSKIVGAPMHDLLLWNNATVTTCHSKTAHDEEVNKGDILVVATGQPEMV
1yb1A           --------------EIVLITGAGHGIGRLTAYEFAKLKSKLVLWDGLEETAAKCKGLGAKVHTFVVDCSN
2ib0A1          --------VEHATI--YGYGIVSALSPPGVNFLVADALKQHRHRIVMLSARGVTAPIAAAGYQLPMQV--
1b8pA1          --------------MRVAVTGAAGQICYSLLFRIANGDMLG-----------------------------
1eq2A           ----------------IIVTGGAGFIGSNIVKALNDKGITDILVVDNLKDGTKF----------------
1p9oA           ---TKVPLEARPVRF--LDNFSSGRRGATSAEAFLAAGYGVLFLYRARSAFPYAHRFPPQT---------
1jr2A           SFEFLSLPSFSEKLYGGLIFTSPRAVEAAELCLEQNNK--------------------------------
1db3A           --------------KVALITGVTGQDGSYLAEFLLEKGYEVHGI--------------------------
2bkaA1          --------------KSVFILGASGETGRVLLKEILEQGL-------------------------------
1ae1A           --------------TTALVTGGSKGIGYAIVEELAGLGARV-----------------------------
1xg5A           --------------RLALVTGASGGIGAAVARALVQQGLKVVGCARTVGN--------------------
1eyzA2          --------------TRVMLLGS-GELGKEVAIECQRLGVEVIAVDRYADAPAMHVAHRSH-VINMLDGDA
1kolA2          GAV-TAGVGPGSTV---YVAGA-GPVGLAAAASARLLGAAVVVGDLNPARLAHAKAQGFEIADLSLDTPL
1b6rA2          -------------MKQVCVLGN-GQLGRMLRQAGEPLGIAVWPVGLDAEPAAVPFQQSV------ITAEI
1zemA1          --------------KVCLVTGAGGNIGLATALRLAEEGTAIALLDMNREAEASVREKGVEARSYVCDVTS
1snyA           --------------NSILITGCNRGLGVKALLNLPQPPQHLFTT--------------------------
1y81A1          --------------RKIALVGASKNPAKYGNIILLSKGFEVLPVNPNYD-----EIEGLKCYRSVRELPK
1bxkA           --------------RKILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSL-------------


                         .         .         .         +         .         .         .:280
query           DARPLDKGLWDGVVDTVGGKILANALAQTRDNGIVAACGNASDYKLNTTVMPFIIRGVKLWGINSVTASI
1o89A2          SRPLEKQV-WAGAIDTVGDKVLAKVLAQMNYGGCVAACGLAGGFTLPTTVMPFILRNVRLQGVDSVMTPP
1ztpA1          VLEADSAIRAAGILTYKPDVYTYLGIYRANRWHLCPTLYES-----------------------------
1o89A1          ----------------------------------------------------------------------
1kolA1          ----------------------------------------------------------------------
1yb5A2          IKKYVGEKGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGTIEIN--PRDTMAKESSIIGVTLFSSTK
1v3tA2          ALKKASPDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGAISVYPPGPSPESIIYKQLRIEGFIVYRWQG
1a71A2          PITEMSNGGVDFSFEVIGRLMVTALSCCQEAYGVSVIVGVPPDSQNLSMNPMLLLSGRTWKG--AIFGGF
1gu7A1          ----------------------------------------------------------------------
1lluA2          VEAIQRDIGGAHGVTAVSNSAFGQAIGMARRGGTIALVGLPPG-DFPTPIFDVVLKGLHIAG--------
1pqwA           ILELTDGYGVDVVLNSLAGEAIQRGVQILAPGGRFIELGKKDVYADASLGLAALAKSASFSVVDNLKLQP
1v3tA1          ----------------------------------------------------------------------
1iyzA2          VPERAKAWGGLDLVLEVRGKEVEESLGLLAHGGRLVYIGAAEAP---IPPLRLMRRNLAVLG--FWLTPL
1wkvA1          ----------------------------------------------------------------------
1e3jA1          ----------------------------------------------------------------------
1qorA1          ----------------------------------------------------------------------
1bxzA1          ----------------------------------------------------------------------
1h2bA2          VMELTRGRGVNVAMDFVGSQATDYTPYLLGRMGRLIIVGYGGELRFP--TIRVISSEVSFEG--------
1vj1A1          ----------------------------------------------------------------------
1o8cA2          ----------------------------------------------------------------------
1e3jA2          EERSAIGDLPNVTIDCSGNEKCITIGINITRTGGTLMLVGMGSQMVTVPLVNACAREIDIKSV-------
2oplA1          ----------------------------------------------------------------------
1a71A1          ----------------------------------------------------------------------
1gv8A           ----------------------------------------------------------------------
1f8fA1          ----------------------------------------------------------------------
1uufA1          ----------------------------------------------------------------------
1a9xA3          TYIEIEKERPDAVLPTMGGQTALNCALELERQGVLEEFGVTM----------------------------
1vj0A1          ----------------------------------------------------------------------
1piwA2          DWGEKYFDTFDLIVVCASSLTFNIMPKAMKVGGRIVSIS-IPEQHEMLSLKPYGLKAVSISY--SALGSI
1iyzA1          ----------------------------------------------------------------------
1aorA1          ----------------------------------------------------------------------
1vm6A3          TVDLCKKYRAGLVLGTTA----------------------------------------------------
1sb8A           DIRNLD----------------------------------------------------------------
1qycA           ----------------------------------------------------------------------
2hjsA1          ----------------------------------------------------------------------
1bxzA2          ESQIMNKGVDAAIIAGGNADIMATAVKIVKPGGTIANVNYFGELPVPRLEWGCGMAHKTIKG--------
1c3vA1          NLEFLIDNGIHAVVGTTGFTAERFQQVESWL---------------------------------------
1vl0A           VDKCEEQYDLAYKINAIGPKNLAAAAYSVGAEIVQISTDAKEPITEFDEVNPQSAYGKKLEGENFVKALI
1i24A           KA--------------------------------------------------------------------
2a35A1          ----------------------------------------------------------------------
1k6iA           ----------------------------------------------------------------------
1xq6A           ----------------------------------------------------------------------
1a9yA           ----------------------------------------------------------------------
1ujmA           VEDXLKQGAYDEVIKGA-AGVAHIASVVSFSNKYDEVVTPAIGGTLNALRAAAATPSVKRFVLTSSTVSA
2c54A1          ----------------------------------------------------------------------
2b69A1          LYIEVD----------------------------------------------------------------
1tdjA1          ----------------------------------------------------------------------
1nasA           VLAAADLGTEAGVQRLLSAVRELPRPEGLQRLLLINNAATLGD---------------------------
1a4iA1          KGEWIKPGAIVIDCGIN-----------------------------------------------------
1yb1A           RE--------------------------------------------------------------------
2ib0A1          ----------------------------------------------------------------------
1b8pA1          ----------------------------------------------------------------------
1eq2A           ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
1jr2A           ----------------------------------------------------------------------
1db3A           ----------------------------------------------------------------------
2bkaA1          ----------------------------------------------------------------------
1ae1A           ----------------------------------------------------------------------
1xg5A           ----------------------------------------------------------------------
1eyzA2          LRRVVELEKPHYIVPEIEAIATDMLIQLEEEGLNVVPCA-------------------------------
1kolA2          HEQIAGEPEVDCAVDAVGFEARGHGHEGAKHEAPATVLNSLMQ---------------------------
1b6rA2          ERWPET----------------------------------------------------------------
1zemA1          E---------------------------------------------------------------------
1snyA           ----------------------------------------------------------------------
1y81A1          DV--------DVIVFVVPPKVGLQVAKEAVEAGFKKLWF-------------------------------
1bxkA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KRREFVWNEVKSLIDFEQLEKSIKTVSLEDLIDIYPKMLKGETSGRYxxxxxx
1o89A2          ERRAQAWQRLVADLP--------------------------------------
1ztpA1          -----------------------------------------------------
1o89A1          -----------------------------------------------------
1kolA1          -----------------------------------------------------
1yb5A2          EEFQQYAAALQAGME--------------------------------------
1v3tA2          DVREKALRDLMKWVL--------------------------------------
1a71A2          KSKDS-VPKLVADFM--------------------------------------
1gu7A1          -----------------------------------------------------
1lluA2          -----------------------------------------------------
1pqwA           ARYRQLLQHILQHVA----DGKLEVLPV-------------------------
1v3tA1          -----------------------------------------------------
1iyzA2          LREEEALGFLLPRLG--------------------------------------
1wkvA1          -----------------------------------------------------
1e3jA1          -----------------------------------------------------
1qorA1          -----------------------------------------------------
1bxzA1          -----------------------------------------------------
1h2bA2          -----------------------------------------------------
1vj1A1          -----------------------------------------------------
1o8cA2          -----------------------------------------------------
1e3jA2          -----------------------------------------------------
2oplA1          -----------------------------------------------------
1a71A1          -----------------------------------------------------
1gv8A           -----------------------------------------------------
1f8fA1          -----------------------------------------------------
1uufA1          -----------------------------------------------------
1a9xA3          -----------------------------------------------------
1vj0A1          -----------------------------------------------------
1piwA2          K-------ELNQLLKLVS-EKDIK-----------------------------
1iyzA1          -----------------------------------------------------
1aorA1          -----------------------------------------------------
1vm6A3          -----------------------------------------------------
1sb8A           -----------------------------------------------------
1qycA           -----------------------------------------------------
2hjsA1          -----------------------------------------------------
1bxzA2          -----------------------------------------------------
1c3vA1          -----------------------------------------------------
1vl0A           VRTAWLYNFVKTXINLGKTHDELKVVSTVDLARVVLKVIDEKNYGTF------
1i24A           -----------------------------------------------------
2a35A1          -----------------------------------------------------
1k6iA           -----------------------------------------------------
1xq6A           -----------------------------------------------------
1a9yA           -----------------------------------------------------
1ujmA           LIPKPNV----------------------------------------------
2c54A1          -----------------------------------------------------
2b69A1          -----------------------------------------------------
1tdjA1          -----------------------------------------------------
1nasA           -----------------------------------------------------
1a4iA1          -----------------------------------------------------
1yb1A           -----------------------------------------------------
2ib0A1          -----------------------------------------------------
1b8pA1          -----------------------------------------------------
1eq2A           -----------------------------------------------------
1p9oA           -----------------------------------------------------
1jr2A           -----------------------------------------------------
1db3A           -----------------------------------------------------
2bkaA1          -----------------------------------------------------
1ae1A           -----------------------------------------------------
1xg5A           -----------------------------------------------------
1eyzA2          -----------------------------------------------------
1kolA2          -----------------------------------------------------
1b6rA2          -----------------------------------------------------
1zemA1          -----------------------------------------------------
1snyA           -----------------------------------------------------
1y81A1          -----------------------------------------------------
1bxkA           -----------------------------------------------------