[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for pubi0:AAZ22059.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1d4aA.bssp"
#ERROR : Can't open dsspfile "1t5bA.bssp"
#ERROR : Can't open dsspfile "2fzvA1.bssp"
#ERROR : Can't open dsspfile "1rttA.bssp"
#ERROR : Can't open dsspfile "1t0iA.bssp"
#ERROR : Can't open dsspfile "1zwkA1.bssp"
#ERROR : Can't open dsspfile "1rliA.bssp"
#ERROR : Can't open dsspfile "1ydgA.bssp"
#ERROR : Can't open dsspfile "1nni1.bssp"
#ERROR : Can't open dsspfile "1vmeA1.bssp"
#ERROR : Can't open dsspfile "2arkA1.bssp"

## Summary of PDB Search
:189
    5e-33  25%  1d4aA  [c.23.5.3] QUINONE REDUCTASE
    4e-20  16%  1t5bA  [c.23.5.3] ACYL CARRIER PROTEIN PHOSPHODIESTERASE
    2e-19  14%  2fzvA1 [c.23.5.4] PUTATIVE ARSENICAL RESISTANCE PROTEIN A:1 -- 233
    5e-17  16%  1rttA  [c.23.5.4] CONSERVED HYPOTHETICAL PROTEIN
    1e-15  18%  1t0iA  [c.23.5.4] YLR011WP
    2e-14  19%  1zwkA1 [c.23.5.8] TRP REPRESSOR BINDING PROTEIN WRBA A:4 -- 196
    1e-13  16%  1rliA  [c.23.5.6] TRP REPRESSOR BINDING PROTEIN
    7e-10  14%  1ydgA  [c.23.5.8] TRP REPRESSOR BINDING PROTEIN WRBA
    8e-06  22%  1nni1  [c.23.5.4] HYPOTHETICAL PROTEIN YHDA
    2e-05  13%  1vmeA1 [c.23.5.1] FLAVOPROTEIN A:251 -- 398
    4e-04  22%  2arkA1 [c.23.5.8] FLAVODOXIN A:1 -- 184
:189

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKKIFLLYGHYNEKSFNAAIRDTFIKTAEKNGNTVDCVDLYKDKFNPVFAGEQAGEDVLDHRRRIEKCDI
1d4aA           -RRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITPDIVAEQKKLEAADL
1t5bA           MSKVLVLKSSILGYSQSGQLTDYFIEQWREKADEITVRDLAANPVPVLDGELVGAMLSDELIAELKAHDV
2fzvA1          PVRILLLYGSLRARSFSRLAVEEAARLLQFFGAETRIFDPSDLPLPD-QVQSDDHPAVKELRALSEWSEG
1rttA           --KVLGISGSLRSGSYNSAALQEAIGLVPP-GMSIELADISGIPLYNEDVYALGFPAVERFREQIRAADA
1t0iA           --KVGIIMGSVRAKRVCPEIAAYVKRTIEDQKLKIQVVDLQQIALPLYEDDDELIPKTRSWSRIVNALDI
1zwkA1          --YILVLYYSRH--GATAEMARQIARGVEQGGFEARVRTVPAVSTEG---------ALYATLEDLKNCAG
1rliA           --KIAVINGGTRSGGNTDVLAEKAVQGFDAEHIYLD---------------------YDSIIERILQCHI
1ydgA           -------------------------------------------------------DVPEATPADLEWAEA
1nni1           ----LVINGTPRKHGRTRIAASYIAALYH-----TDLIDL-SEFVLPVFNGEAELLKVQELKQRVTKADA
1vmeA1          -GKVTVIYDGFVEN-----VXKKAIDSLKEKGFTPVVYKFSDEER----------PAISEILKDIPDSEA
2arkA1          ----------------------------------------------------------------VLWADG


                         .         .         *         .         .         .         .:140
query           IVLIAPIWNFRMPAIVEGWIDKVLSPPWAYTFKKLVGNYGYPMGNLKDKKAIIFCTYGSPRLAVTTFFLN
1d4aA           VIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAA-----MYDKGPFRSKKAVLSITTGGSGSMYSLQGIH
1t5bA           IVIAAPMYNFNIPTQLKNYFDLIARAGITFRYTEK-----GPEGLVTGKRAVVLSSRGGIHKDTPTDLIA
2fzvA1          QVWCSPERHGQITSVMKAQIDHLPLEMAGI-------------RPTQGRTLAVMQVSGGSQSFNAVNTLR
1rttA           LLFATPEYNYSMAGVLKNAIDWA---------------SRPPEQPFSGKPAAILGASAGRFGTARA----
1t0iA           IVFVTPQYNWGYPAALKNAIDRLYHEWH-------------------GKPALVVSYGGHGGSKCNDQL--
1zwkA1          LALGSPTRFGNMASPLKYFLDG-TSSLWLT-------------GSLVGKPAAVFTSTASLHGGQETTQLS
1rliA           LIFATPIYWFGMSGTLKLFIDRWSQTLRDPR-------FPDFKQQMSVKQAYVIAVGGDNP---KIKGLP
1ydgA           IVFSSPTRFGGATSQMRAFIDTLGGL--------------WSSGKLANKTFSAMTSAQNVNGGQETTLQT
1nni1           IVLLSPEYHSGXSGALKNALDFLSSEQFKY----------------------------------------
1vmeA1          LIFGVSTYEAEIH------------PLXRFTLLEIID------KANYEKPVLVFGVHG------------
2arkA1          LAVGSPTNXGLVSWKXKRFFDDVLGDLW---------------GEIDGKIACAFSSSGGW----------


                         +         .         .         .         .         *         .:210
query           LPIRRLKRGVFHMCGIYNIVYRRYFAVPFVTDEKRKEFLEDVKKTANNI
1d4aA           GDMNVIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENI
1t5bA           PYL----KVFLGFIGITDVNFVFAEGIAYGPEVAAK-------------
2fzvA1          LLGRWMRFTIPNQSSIAK-AFQEFDAAGRMKPSPYYDRIADV-------
1rttA           --QYHL-RQTLVFLDV-HPLNKPEVMISSAQNA----------------
1t0iA           -------QEVLHGLKM-NVIGGVAVKIPVGTIPLPEDIVPQLSVHNEEI
1zwkA1          MLLPLLHHGM---------------------------------------
1rliA           L-IQQF-EHIFHFMGMSFKGYVLGEGNRPGDILRDHQALSAASRLLKRS
1ydgA           L------YMTAMHWGAVLTPPGYTDEVIFKSG-----------------
1nni1           -------------------------------------------------
1vmeA1          -------------------------------------------------
2arkA1          -------------------------------------------------