[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for pubi0:AAZ22091.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1rrmA.bssp"
#ERROR : Can't open dsspfile "1oj7A.bssp"
#ERROR : Can't open dsspfile "1vljA.bssp"
#ERROR : Can't open dsspfile "1o2dA.bssp"
#ERROR : Can't open dsspfile "1dqsA.bssp"
#ERROR : Can't open dsspfile "1jpuA.bssp"
#ERROR : Can't open dsspfile "1ujnA.bssp"
#ERROR : Can't open dsspfile "1kzhA.bssp"
#ERROR : Can't open dsspfile "1occE.bssp"

## Summary of PDB Search
:388
    1e-88  30%  1rrmA  [e.22.1.2] LACTALDEHYDE REDUCTASE
    2e-76  21%  1oj7A  [e.22.1.2] HYPOTHETICAL OXIDOREDUCTASE YQHD
    4e-69  25%  1vljA  [e.22.1.2] NADH-DEPENDENT BUTANOL DEHYDROGENASE
    5e-65  23%  1o2dA  [e.22.1.2] ALCOHOL DEHYDROGENASE, IRON-CONTAINING
    1e-42  15%  1dqsA  [e.22.1.1] PROTEIN (3-DEHYDROQUINATE SYNTHASE)
    6e-41  28%  1jpuA  [e.22.1.2] GLYCEROL DEHYDROGENASE
    8e-41  17%  1ujnA  [e.22.1.1] DEHYDROQUINATE SYNTHASE
    2e-37  10%  1kzhA  [c.89.1.1] PHOSPHOFRUCTOKINASE
    6e-13   9%  1occE  [a.118.11.1] CYTOCHROME C OXIDASE
:388

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQKYNWNYPTTMWVGENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGIIAALYSXXXX
1rrmA           --------NETAWFGRGAVGALTDEVKRRGYQKALIVTDKTLVQCGVVAKVTDKXDAAGLAWAIYDGVVP
1oj7A           LNNFNLHTPTRILFGKGAIAGLREQIPHDA-RVLITYGGGSVKKTGVLDQVLDALK--GMDVLEFGGIEP
1vljA           MENFVFHNPTKIVFGRGTIPKIGEEIKNAGIRKVLFLYGGGIKKNGVYDQVVDSLKKHGIEWVEVSGVKP
1o2dA           ---WEFYXPTDVFFGEKILEKRGNIIDLLGKRALVVTGKSSSKKNGSLDDLKKLLDETEISYEIFDEVEE
1dqsA           ------RESIIADFGLWRNYVAKDLISDCSSTTYVLVTDTNIGS-IYTPSFEEAFRKRAAEITPSPPGEV
1jpuA           --------PAKYVQGKNVITKIANYLEGIG-NKTVVIADEIVWK-IAGHTIVNELKKGNI-AAEEVVFSG
1ujnA           MQRVREPVPYPILVGEGVLKEVPPL-----AGPAALLFDRRVEG--FAQEVAKALGVRHLL--GLPGGEA
1kzhA           ----------------------------------------------LTESLINSYRNTGGFDIVSSGRTK
1occE           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIWDFEDVGDNWTKANSDKIAPIIA
1rrmA           NPTITVVKEGLGVFQNSGADYLIAIGGGSPQDTCKAIGIISNNP----EFADVRSLEGLSPTNKPSPILA
1oj7A           NPAYETLMNAVKLVREQKVTFLLAVGGGSVLDGTKFIAAAAPENIDPWHILQTGGKEIK----SAIPMGC
1vljA           NPVLSKVHEAVEVAKKEKVEAVLGVGGGSVVDSAKAVAAGALYEGDIWDAFIGKYQIEKA-----LPIFD
1o2dA           NPSFDNVXKAVERYRNDSFDFVVGLGGGSPXDFAKAVAVLLKEKDLSVEDLYDREKVKHW-----LPVVE
1dqsA           SKSRQTKADIEDWMLSQNPTVVIALGGGVIGDLTGFVASTYMRGVRY---------------------VQ
1jpuA           EASRNEVERIANIARKAEAAIVIGVGGGKTLDTAKAVADELD-----------------------AYIVI
1ujnA           AKSLEVYGKVLSWLAEKGLPRNATLGGGTLTDLGGFVA---------------------ATYLRGVAYLA
1kzhA           IETEEHYNKALFVAKENNLNAIIIIGGDDSNTNAAILAEYFKKNGENIQVIGV-----PKTIDADLRNDH
1occE           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGLPAKMTAATGMDALAHNLEAYCA
1rrmA           IPTTAGTAAEVTINYVITDEEKRRKFVCVDPHDIPQVAFIDADXXDGXPPALKAATGVDALTHAIEGYIT
1oj7A           VLTLPATGSESNAGAVISRKTTGDKQAFHSAHVQPVFAVLDPVYTYTLPPRQVANGVVDAFVHTVEQYVT
1vljA           VLTISATGTEMNGNAVITNEKTKEKYGVSSKALYPKVSIIDPSVQFTLPKEQTVYGAVDAISHILEYYFD
1o2dA           IPTTAGTGSEVTPYSILTDPEGNKRGCTLXF---PVYAFLDPRYTYSXSDELTLSTGVDALSHAVEGYLS
1dqsA           VPTTLLAMVDSSIGGKTAIDTPLGKNLI-GAIWQPTKIYIDLEFLETLPVREFINGMAEVIKTAAISS-E
1jpuA           VPTAASTDAPTSALSVGVFESY-----RFYKK-NPDLVLVDTKIIANAPPRLLASGIADALATWVEARIK
1ujnA           FPTTTLAIVDASVGGKTGINLPEGKNLV-GAFHFPQGVYAELRALKTLPLPTFKEGLVEAFKHGLIAGDE
1kzhA           IEISFGFDSATKIYSELIGNLCYWHFVKLMGRSASHVALECALKTHPLAKKKTLSEIIDEMVSVILKRSL
1occE           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PGYHPMADGIALEGMRLIDKWLLEAVSNGSNIEARMNMLTAASMGSTAFQKGLGAIHSLSHPVNALNNIH
1rrmA           RGAWALTDALHIKAIEIIAGALRGSV--AGDKDAGEEXALGQYVAGXGFNVGLGLVHGXAHPLGAFYNTP
1oj7A           KPVDKIHDRFAEGILLTLIEDGPKALKEPENYDVRANVMWAATQALNGLVPQDWATHMLGHELTAMHGLD
1vljA           GSSPEISNEIAEGTIRTIMKMTERLIEKPDDYEARANLAWSATIALNGTRGGEWACHRIEHSLSALYDIA
1o2dA           RKSTPPSDALAIEAXKIIHRNLPKAIEG--NREARKKXFVASCLAGXVIQTGTTLAHALGYPLTTEKGIK
1dqsA           EEFTALEENTILKAVRRRFEGTEEILKARILASARHKAYVVSADEREGGRNLLNWGHSIGHAIEAILTPQ
1jpuA           SGGKTMAGGIPTIAAEAIAEKCYESVKAKVVTPALEAVVEANTLSGLGFESGLAAAHAIHNGFTALHHLT
1ujnA           EDLTPQSPRLEAFLARAVAVKVRVTEEDPLEKGKRRLLNLGHTLG--------HALEAQTRH-----ALP
1kzhA           NGDNFGVVIVP----EGLIEFIPEVKSLMLELCDIFDKNEGEFKGLNIEMKEIFVAKLSDYMKGVYLSLP
1occE           -----------------------------------------SHGSHETDEEDARWVTYFNKPDIDAWELR


                         .         *         .         .         .         .         +:350
query           HGLSNAIFMPYVLTFNKDVIENKIIKICDYLELKDRSFDGFVNWVLDLRKKLDMPHKLSEVIDEKDFDID
1rrmA           HGVANAILLPHVXRYNADFTGEKYRDIARVXGVKVEGRNAAVEAVFALNRDVGIPPHLRDVVRKE--DIP
1oj7A           HAQTLAIVLPALWNEKRDTKRAKLLQYAERVGSDDERIDAAIAATRNFFEQLGVPTHLSDYLDGSSIP-A
1vljA           HGAGLAIVFPAWMKYVYRKNPAQFERFAK----KIFGFEGGIEAFKNWLKKVGAPVSLKD-AGIPEEDID
1o2dA           HGKATGXVLPFVXEVXKEEIPEKVDTVNHIF----------GGSLLKFLKELGLYEKVA----VSSEELE
1dqsA           ILHGECVAIGMVKEA----------ELARHLGILK---GVAVSRIVKCLAAYGLPTSLKD-ARIRKLTAG
1jpuA           HGEKVAFGTLVQL----------------ALEEHS---QQEIERYIELYLCLDLPVTLEDILKDASRDIL
1ujnA           HGMAVAYGLLY-----------------------------------------------------------
1kzhA           LFIQFELIKSILERDPHGNFNVSRVPTEKLFIEMI--QSRLNDMKKRGEYKGSFTPVDHFFGYEG-RSAF
1occE           KGMNTLVGYPKIIDAALRACRASAVRILEVVKDKAGPYPYVIQELRPTLNELGIS-TPEELLDK------


                         .         .         .         .         *         .         .:420
query           RLSKMALADPSTGGNPKKLTEDDMRIMYQNSMTGELxx
1rrmA           ALAQAALDDVCTGGNPREATLEDIVELYHTAWEG----
1oj7A           LLKKLEEHGMTQLGENHDITLDVSRRIYEAA-------
1vljA           KIVDNVMLLVEKNLKPKGASLGRIMVLEREDVREIL--
1o2dA           KWVEKGSRAKHLKNTPGTFTPEKIRNIYREAL------
1dqsA           KMFNMALDKKNDGPKKK---------------------
1jpuA           KVAKAATAEGETIHNAFNVTADDV--------------
1ujnA           --------------------------------------
1kzhA           PSNFDSDYCYSLGYNAVVLILNGLTGYM----------
1occE           --------------------------------------