[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rcon0:cyaY

[Show Plain Result]

#ERROR : Can't open dsspfile "1xaqA.bssp"
#ERROR : Can't open dsspfile "2fqlA.bssp"
#ERROR : Can't open dsspfile "1ew4A.bssp"
#ERROR : Can't open dsspfile "1ly7A.bssp"
#ERROR : Can't open dsspfile "1ekgA.bssp"
#ERROR : Can't open dsspfile "1dlxA.bssp"

## Summary of PDB Search
:103
    8e-12  50%  1xaqA  [x.x.x] FRATAXIN HOMOLOG, MITOCHONDRIAL
    8e-12  50%  2fqlA  [x.x.x] FRATAXIN HOMOLOG, MITOCHONDRIAL
    3e-10  32%  1ew4A  [d.82.2] CYAY PROTEIN
    6e-10  41%  1ly7A  [d.82.2] FRATAXIN
    1e-09  40%  1ekgA  [d.82.2] FRATAXIN
    2e-09  40%  1dlxA  [x.x.x] FRATAXIN
:103

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNNSEFSKIAETTIAYIAEKIEEQDKEASIDVDLQGDILNLDTDKGVYVINKQSAAKEIWLSSPVSGPYH
1xaqA           ------------------------------DVELSHGVMTLEIPAGTYVINKQPPNKQIWLASPLSGPNR
2fqlA           ------------------------------DVELSHGVMTLEIPAGTYVINKQPPNKQIWLASPLSGPNR
1ew4A           MNDSEFHRLADQLWLTIEERLDDWDGDSDIDCEINGGVLTITFENGKIIINRQEPLHQVWLATK-QGGYH
1ly7A           MDETTYERLAEETLDSLAEFFEDADKPYTFDVSFGSGVLTLGGDLGTYVINKQTPNKQIWLSSPSSGPKR
1ekgA           LDETTYERLAEETLDSLAEFFEDADKPYTFDVSFGSGVLTLGGDLGTYVINKQTPNKQIWLSSPSSGPKR
1dlxA           -DETTYERLAEETLDSLAEFFEDADKPYTFDVSFGSGVLTLGGDLGTYVINKQTPNKQIWLSSPSSGPKR


                         .         .         *         .         .         .         .:140
query           FFYEQGEWTNRAGLELMAILTEELxxxxxxxxx
1xaqA           FDLLNGEWVSRNGTKLTDILTEEV---------
2fqlA           FDLLNGEWVSRNGTKLTDILTEEV---------
1ew4A           FDLKGDEW-------------------------
1ly7A           YDWTGKNW-------------------------
1ekgA           YDWTGKNW-------------------------
1dlxA           YDWTGKNW-------------------------