[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rcon0:AAL03106.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2v50E.bssp"
#ERROR : Can't open dsspfile "2v50B.bssp"
#ERROR : Can't open dsspfile "2v50A.bssp"
#ERROR : Can't open dsspfile "2v50D.bssp"

## Summary of PDB Search
:169
    1e-10  26%  2v50E  [x.x.x] MULTIDRUG RESISTANCE PROTEIN MEXB
    1e-10  26%  2v50B  [x.x.x] MULTIDRUG RESISTANCE PROTEIN MEXB
    1e-10  26%  2v50A  [x.x.x] MULTIDRUG RESISTANCE PROTEIN MEXB
    2e-09  26%  2v50D  [x.x.x] MULTIDRUG RESISTANCE PROTEIN MEXB
:169

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxYAETIMAERLSMLPGVAQIQVYGSQQYAVRVQIDPVKMAVNNIGLDQVSNIISSANVNLPTGALYGT
2v50E           ---YIVSNIQDPLSRTKGVGDFQVFGSQ-YSMRIWLDPAKLNSYQLTPGDVSSAIQAQNVQISSGAVKGQ
2v50B           ---YIVSNIQDPLSRTKGVGDFQVFGSQ-YSMRIWLDPAKLNSYQLTPGDVSSAIQAQNVQISSGAVKGQ
2v50A           ---YIVSNIQDPLSRTKGVGDFQVFGSQ-YSMRIWLDPAKLNSYQLTPGDVSSAIQAQNVQISSGAVKGQ
2v50D           ---YIVSNIQDPLSRTKGVGDFQVFGSQ-YSMRIWLDPAKLNSYQLTPGDVSSAIQAQNVQISSGAVKGQ


                         .         .         *         .         .         .         .:140
query           DIYSSIRAPGQLQNVKEYNELILTYKNGNPLFLKNIGKTIDSVANNKIAAWYRDKPGVILAIQKQPDTTN
2v50E           QLNATIIGKTRLQTAEQFENILLKVNDGSQVRLKDVADVGLGGQDYSINAQFNGSPASGIAI-KLATGAN
2v50B           QLNATIIGKTRLQTAEQFENILLKVNDGSQVRLKDVADVGLGGQDYSINAQFNGSPASGIAI-KLATGAN
2v50A           QLNATIIGKTRLQTAEQFENILLKVNDGSQVRLKDVADVGLGGQDYSINAQFNGSPASGIAI-KLATGAN
2v50D           QLNATIIGKTRLQTAEQFENILLK--------LKDVADVGLGGQDYSINAQFNGSPASGIAI-KLATGAN


                         +         .         .         .         .         *         .:210
query           TIEIVDSIKEVLPLLRRQIPEGINIxxxx
2v50E           ALDTAKAIRQTIANLEPFMPQGMKV----
2v50B           ALDTAKAIRQTIANLEPFMPQGMKV----
2v50A           ALDTAKAIRQTIANLEPFMPQGMKV----
2v50D           ALDTAKAIRQTIANLEPFMPQGMKV----