[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rcon0:AAL03110.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1wp1A.bssp"
#ERROR : Can't open dsspfile "3d5kA.bssp"
#ERROR : Can't open dsspfile "1wp1B.bssp"

## Summary of PDB Search
:125
    1e-10  36%  1wp1A  [f.5.1] OUTER MEMBRANE PROTEIN OPRM
    1e-10  36%  3d5kA  [x.x.x] OUTER MEMBRANE PROTEIN OPRM
    1e-06  38%  1wp1B  [f.5.1] OUTER MEMBRANE PROTEIN OPRM
:125

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxEQETTLKILVGRIPENIVNGLIYRNKPIDYFPALPVLPKILPSELLEQRPDIKAAEQNLLA
1wp1A           ---------DQNALVLLLGSGIPANLPQGL-----GLDQ-TLLTEVPAGLPSDLLQRRPDILEAEHQLMX
3d5kA           ---------DQNALVLLLGSGIPANLPQGL-----GLDQ-TLLTEVPAGLPSDLLQRRPDILEAEHQLMX
1wp1B           ---------DQNALVLLLGSGIPANLPQGL-----GLDQ-TLLTEVPAGLPSDLLQRRPDILEAEHQLMX


                         .         .         *         .         .         .         .:140
query           ADVNLKTIKATYFPQISLTGLLGFGSNKLNTLFTNSAETWQVDGNIAGPIFDFGx
1wp1A           XXXXXXXXXXXFFPSISLTANAGTMSRQLSGLFDAGSGSWLFQPSINLPIFTAG-
3d5kA           XXXXXXXXXXXFFPSISLTANAGTMSRQLSGLFDAGSGSWLFQPSINLPIFTAG-
1wp1B           XXXXXXXXXXXFFPSISLTSWL---------------------------------