[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rcon0:addA

[Show Plain Result]

#ERROR : Can't open dsspfile "2z7bA.bssp"
#ERROR : Can't open dsspfile "1e48P.bssp"
#ERROR : Can't open dsspfile "1dzzP.bssp"
#ERROR : Can't open dsspfile "1dzvP.bssp"
#ERROR : Can't open dsspfile "1e4cP.bssp"
#ERROR : Can't open dsspfile "1e46P.bssp"
#ERROR : Can't open dsspfile "2fuaA.bssp"
#ERROR : Can't open dsspfile "1fuaA.bssp"
#ERROR : Can't open dsspfile "1e47P.bssp"
#ERROR : Can't open dsspfile "1dzxP.bssp"
#ERROR : Can't open dsspfile "1e4bP.bssp"
#ERROR : Can't open dsspfile "1dzwP.bssp"
#ERROR : Can't open dsspfile "1e49P.bssp"
#ERROR : Can't open dsspfile "1dzuP.bssp"
#ERROR : Can't open dsspfile "1e4aP.bssp"
#ERROR : Can't open dsspfile "2flfH.bssp"
#ERROR : Can't open dsspfile "2flfG.bssp"
#ERROR : Can't open dsspfile "2flfF.bssp"
#ERROR : Can't open dsspfile "2flfE.bssp"
#ERROR : Can't open dsspfile "2flfB.bssp"
#ERROR : Can't open dsspfile "2flfA.bssp"
#ERROR : Can't open dsspfile "2fk5B.bssp"
#ERROR : Can't open dsspfile "2fk5A.bssp"
#ERROR : Can't open dsspfile "2flfC.bssp"
#ERROR : Can't open dsspfile "2irpB.bssp"
#ERROR : Can't open dsspfile "2irpA.bssp"
#ERROR : Can't open dsspfile "1k0wA.bssp"
#ERROR : Can't open dsspfile "1jdiA.bssp"
#ERROR : Can't open dsspfile "2opiB.bssp"
#ERROR : Can't open dsspfile "2opiA.bssp"

## Summary of PDB Search
:231
    4e-14  24%  2z7bA  [x.x.x] MLR6791 PROTEIN
    1e-09  28%  1e48P  [c.74.1] L-FUCULOSE 1-PHOSPHATE ALDOLASE
    1e-09  28%  1dzzP  [c.74.1] L-FUCULOSE-1-PHOSPHATE ALDOLASE
    1e-09  28%  1dzvP  [c.74.1] L-FUCULOSE-1-PHOSPHATE ALDOLASE
    1e-09  28%  1e4cP  [c.74.1] L-FUCULOSE 1-PHOSPHATE ALDOLASE
    1e-09  27%  1e46P  [c.74.1] L-FUCULOSE 1-PHOSPHATE ALDOLASE
    2e-09  27%  2fuaA  [x.x.x] L-FUCULOSE-1-PHOSPHATE ALDOLASE
    2e-09  27%  1fuaA  [c.74.1 (1dzyP)] L-FUCULOSE-1-PHOSPHATE ALDOLASE
    2e-09  27%  1e47P  [c.74.1] L-FUCULOSE 1-PHOSPHATE ALDOLASE
    2e-09  27%  1dzxP  [c.74.1] L-FUCULOSE-1-PHOSPHATE ALDOLASE
    3e-09  27%  1e4bP  [c.74.1] L-FUCULOSE 1-PHOSPHATE ALDOLASE
    3e-09  27%  1dzwP  [c.74.1] L-FUCULOSE-1-PHOSPHATE ALDOLASE
    9e-09  27%  1e49P  [c.74.1] L-FUCULOSE 1-PHOSPHATE ALDOLASE
    9e-09  27%  1dzuP  [c.74.1] L-FUCULOSE-1-PHOSPHATE ALDOLASE
    2e-08  28%  1e4aP  [c.74.1] L-FUCULOSE 1-PHOSPHATE ALDOLASE
    3e-07  30%  2flfH  [x.x.x] FUCULOSE-1-PHOSPHATE ALDOLASE
    3e-07  30%  2flfG  [x.x.x] FUCULOSE-1-PHOSPHATE ALDOLASE
    3e-07  30%  2flfF  [x.x.x] FUCULOSE-1-PHOSPHATE ALDOLASE
    3e-07  30%  2flfE  [x.x.x] FUCULOSE-1-PHOSPHATE ALDOLASE
    3e-07  30%  2flfB  [x.x.x] FUCULOSE-1-PHOSPHATE ALDOLASE
    3e-07  29%  2flfA  [x.x.x] FUCULOSE-1-PHOSPHATE ALDOLASE
    5e-07  29%  2fk5B  [x.x.x] FUCULOSE-1-PHOSPHATE ALDOLASE
    5e-07  29%  2fk5A  [x.x.x] FUCULOSE-1-PHOSPHATE ALDOLASE
    6e-07  28%  2flfC  [x.x.x] FUCULOSE-1-PHOSPHATE ALDOLASE
    1e-06  27%  2irpB  [x.x.x] PUTATIVE ALDOLASE CLASS 2 PROTEIN AQ_1979
    1e-06  27%  2irpA  [x.x.x] PUTATIVE ALDOLASE CLASS 2 PROTEIN AQ_1979
    2e-05  26%  1k0wA  [c.74.1] L-RIBULOSE 5 PHOSPHATE 4-EPIMERASE
    2e-05  26%  1jdiA  [c.74.1] L-RIBULOSE 5 PHOSPHATE 4-EPIMERASE
    8e-04  29%  2opiB  [x.x.x] L-FUCULOSE-1-PHOSPHATE ALDOLASE
    8e-04  29%  2opiA  [x.x.x] L-FUCULOSE-1-PHOSPHATE ALDOLASE
:231

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xDIKYNLAAAYRIMAYLSLDDHTYTHLSARPKNAVFYYIYPFGLRFEEVTTENLLKVSLDGQILEGEEYQ
2z7bA           ------LVTATKILLNEGID--TFGHISARDPEDPASFFLAQKLAPSLITVDDIQRFNLDGETSDNRPSY
1e48P           -------------MTRLGLNQGTAGNVSVRYQDGML--ITPTGIPYEKLTESHIVFIDGNGKHEEGK---
1dzzP           -------------MTRLGLNQGTAGNVSVRYQDGML--ITPTGIPYEKLTESHIVFIDGNGKHEEGK---
1dzvP           -------------MTRLGLNQGTAGNVSVRYQDGML--ITPTGIPYEKLTESHIVFIDGNGKHEEGK---
1e4cP           -------------MTRLGLNQGTAGNVSVRYQDGML--ITPTGIPYEKLTESHIVFIDGNGKHEEGKLPQ
1e46P           -------------MTRLGLNQGTAGNVSVRYQDGML--ITPTGIPYEKLTESHIVFIDGNGKHEEGK---
2fuaA           -------------MTRLGLNQGTAGNVSVRYQDGML--ITPTGIPYEKLTESHIVFIDGNGKHEEGK---
1fuaA           -------------MTRLGLNQGTAGNVSVRYQDGML--ITPTGIPYEKLTESHIVFIDGNGKHEEGK---
1e47P           -------------MTRLGLNQGTAGNVSVRYQDGML--ITPTGIPYEKLTESHIVFIDGNGKHEEGK---
1dzxP           -------------MTRLGLNQGTAGNVSVRYQDGML--ITPTGIPYEKLTESHIVFIDGNGKHEEGK---
1e4bP           -------------MTRLGLNQGTAGQVSVRYQDGML--ITPTGIPYEKLTESHIVFIDGNGKHEEGK---
1dzwP           -------------MTRLGLNQGTAGNVSVRYQDGML--ITPTGIPYEKLTESHIVFIDGNGKHEEGK---
1e49P           -------------MTRLGLNQGTAGLVSVRYQDGML--ITPTGIPYEKLTESHIVFIDGNGKHEEGK---
1dzuP           -------------MTRLGLNQGAAGNVSVRYQDGML--ITPTGIPYEKLTESHIVFIDGNGKHEEGK---
1e4aP           --------------------------------------ITPTGIPYEKLTESHIVFIDGNGKHEEGK---
2flfH           ----------------------TAGNFSVRTKGG--FLITKSGVQKARLTPEDLLEVPLEGPIPEGASVE
2flfG           ----------------------TAGNFSVRTKGG--FLITKSGVQKARLTPEDLLEVPLEGPIPEGASVE
2flfF           ----------------------TAGNFSVRTKGG--FLITKSGVQKARLTPEDLLEVPLEGPIPEGASVE
2flfE           ----------------------TAGNFSVRTKGG--FLITKSGVQKARLTPEDLLEVPLEGPIPEGASVE
2flfB           ----------------------TAGNFSVRTKGG--FLITKSGVQKARLTPEDLLEVPLEGPIPEGASVE
2flfA           ----------------------TAGNFSVRTKGG--FLITKSGVQKARLTPEDLLEVPLEGPIPEGASVE
2fk5B           ----------------------TAGNFSVRTKGG--FLITKSGVQKARLTPEDLLEVPLEGPIPEGASVE
2fk5A           ----------------------TAGNFSVRTKGG--FLITKSGVQKARLTPEDLLEVPLEGPIPEGASVE
2flfC           ----------------------TAGNFSVRTKGG--FLITKSGVQKARLTPEDLLEVPLEGPIPEGASVE
2irpB           -----------------------------------------------KLTPEDILLIDYEGRPVGGGKPS
2irpA           -----------------------------------------------KLTPEDILLIDYEGRPVGGGKPS
1k0wA           -DLKRQVLEANLALPKHNLVTLTWGNVSAVDRERGVFVIKPSGVDYSIMTADDMVVVSIEGEVVEGAKKP
1jdiA           -DLKRQVLEANLALPKHNLVTLTWGNVSAVDRERGVFVIKPSGVDYSIMTADDMVVVSIEGEVVEGAKKP
2opiB           ----------------------------------------------------------------------
2opiA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           YNKTGYFIHGSIYKTRPDISAIFHYHTPAAIAVSALKCGLLPISQWALHFYDRISYHNYNSLVLDADKQS
2z7bA           LER---YIHSEIYKTRPDVQCVLHTHSPAVLPYCFVDTPLRPVTHGAVPVYEIRDKHGDETDLFGGSPDV
1e48P           LPSSQWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRSIP-----AIHF--MIAAAGGNSITFGTRELS
1dzzP           LPSSEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRSIP-----AIHF--MIAAAGGNSITFGTRELS
1dzvP           LPSSEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRSIP-----AIHF--MIAAAGGNSITFGTRELS
1e4cP           ---SEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRSIP-----AIHY--MIAAAGGNSITFGTRELS
1e46P           LPSSSWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRSIP-----AIHY--MIAAAGGNSITFGTRELS
2fuaA           LPSSEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRSIP-----AIHY--MIAAAGGNSITFGTRELS
1fuaA           LPSSEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRSIP-----AIHY--MIAAAGGNSITFGTRELS
1e47P           LPSSQWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRSIP-----AIHY--MIAAAGGNSITFGTRELS
1dzxP           LPSSEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRSIP-----AIHY--MIAAAGGNSITFGTRELS
1e4bP           LPSSEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRSIP-----AIHY--MIAAAGGNSITFGTRELS
1dzwP           LPSSEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRSIP-----AIHY--MIAAAGGNSITAGTRELS
1e49P           LPASEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRSIP-----AIHY--MIAAAGGNSITFGTRELS
1dzuP           LPSSEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRSIP-----AIHY--MIAAAGGNSITFGTRELS
1e4aP           LPSSEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRSIP-----AIHY--MIAAAGGNSITFGTRELS
2flfH           S-----VVHREVYR-RTGARALVHAHPRVAVALSFHLSRLRPLDLEGQHYLKEVP------VLAPATEEA
2flfG           S-----VVHREVYR-RTGARALVHAHPRVAVALSFHLSRLRPLDLEGQHYLKEVP------VLAPATEEA
2flfF           S-----VVHREVYR-RTGARALVHAHPRVAVALSFHLSRLRPLDLEGQHYLKEVP------VLAPATEEA
2flfE           S-----VVHREVYR-RTGARALVHAHPRVAVALSFHLSRLRPLDLEGQHYLKEVPV-----LAPKATEEA
2flfB           S-----VVHREVYR-RTGARALVHAHPRVAVALSFHLSRLRPLDLEGQHYLKEVPV-----LAPKATEEA
2flfA           S-----VVHREVYR-RTGARALVHAHPRVAVALSFHLSRLRPLDLEGQHYLKEVPV-----LAPKTEEAA
2fk5B           S-----VVHREVYR-RTGARALVHAHPRVAVALSFHLSRLRPLDLEGQHYLKEVPV--LAPKTVSATEEA
2fk5A           S-----VVHREVYR-RTGARALVHAHPRVAVALSFHLSRLRPLDLEGQHYLKEVPV--LAPKTVSATEEA
2flfC           S-----VVHREVYR-RTGARALVHAHPRVAVALSFHLSRLRPLDLEGQHYLKEVPVLAPKTVTEEA---A
2irpB           AET---LLHTTVYKLFPEVNAVVHTHSPNATVISIVKKDFVELEDYELAFPDIHTHEVKIKIPIFPNEQN
2irpA           AET---LLHTTVYKLFPEVNAVVHTHSPNATVISIVKKDFVELEDYELAFPDIHTHEVKIKIPIFPNEQN
1k0wA           SSDTP--THRLLYQAFPSIGGIVHTHSHATIWAQAGQSIPATGTTHANYFYGTIEWETGNVIVETFEKQG
1jdiA           SSDTP--THRLLYQAFPSIGGIVHTHSHATIWAQAGQSIPATGTTHADYFYGTIEWETGNVIVETFEKQG
2opiB           --------HLGVLRERPDVNVVLHFQSEYATAISCKNTNFNVTAEIPCHVGSEIPVIPYYR--PGSPELA
2opiA           --------HLGVLRERPDVNVVLHFQSEYATAISCKNTNFNVTAEIPCHVGSEIPVIPYYR--PGSPELA


                         +         .         .         .         .         *         .:210
query           SRLVTDLKQNYVMLLRNHGAITCGKTIHEAMFYTYHLEQACKTQCLLNSTKEQELIIPSVEICKQTVKDL
2z7bA           CADIAESLGSQTVVLARHGVVNVGKSVREVVFRAFYLEQEAAALTAGLKIGNVKYLSPG-EI--KTAGKL
1e48P           EHVALALKNRKATLLQHHGLIACEVNLEKALWLAHEVE--------------------------------
1dzzP           EHVALALKNRKATLLQHHGLIACEVNLEKALWLAHEVE--------------------------------
1dzvP           EHVALALKNRKATLLQHHGLIACEVNLEKALWLAHEVE--------------------------------
1e4cP           EHVALALKNRKATLLQHHGLIACEVNLEKALWLAHEVE--------------------------------
1e46P           EHVALALKNRKATLLQHHGLIACEVNLEKALWLAHEVE--------------------------------
2fuaA           EHVALALKNRKATLLQHHGLIACEVNLEKALWLAHEVE--------------------------------
1fuaA           EHVALALKNRKATLLQHHGLIACEVNLEKALWLAHEVE--------------------------------
1e47P           EHVALALKNRKATLLQHHGLIACEVNLEKALWLAHEVE--------------------------------
1dzxP           EHVALALKNRKATLLQHHGLIACEVNLEKALWLAHEVE--------------------------------
1e4bP           EHVALALKNRKATLLQHHGLIACEVNLEKALWLAHEVE--------------------------------
1dzwP           EHVALALKNRKATLLQHHGLIACEVNLEKALWLAHEVE--------------------------------
1e49P           EHVALALKNRKATLLQHHGLIACEVNLEKALWLAHEVE--------------------------------
1dzuP           EHVALALKNRKATLLQHHGLIACEVNLEKALWLAHEVE--------------------------------
1e4aP           EHVALALKNRKATLLQHHGLIACEVNLEKALWLAHEVE--------------------------------
2flfH           ALSVAELREHRACLLRGHGAFAVG----------------------------------------------
2flfG           ALSVAELREHRACLLRGHGAFAVG----------------------------------------------
2flfF           ALSVAELREHRACLLRGHGAFAVG----------------------------------------------
2flfE           ALSVAELREHRACLLRGHGAFAVG----------------------------------------------
2flfB           ALSVAELREHRACLLRGHGAFAVG----------------------------------------------
2flfA           LSVAEALREHRACLLRGHGAFAVG----------------------------------------------
2fk5B           ALSVAELREHRACLLRGHGAFAVG----------------------------------------------
2fk5A           ALSVAELREHRACLLRGHGAFAVG----------------------------------------------
2flfC           LSVAEALREHRACLLRGHGAFAVG----------------------------------------------
2irpB           IPLLAKEVENYFFLIRGHGLYTWGRS-EEALIHTEALE--------------------------------
2irpA           IPLLAKEVENYFFLIRGHGLYTWGRS-EEALIHTEALE--------------------------------
1k0wA           ----IDAAQMPGVLVHSHGPFAWGKNAEDAVHNAIVLEE-------------------------------
1jdiA           ----IDAAQMPGVLVHSHGPFAWGKNAEDAVHNAIVLEE-------------------------------
2opiB           KAVVEALKHNSV-LLTNHGQVVCGK---------------------------------------------
2opiA           KAVVEALKHNSV-LLTNHGQVVCGK---------------------------------------------


                         .         .         .         +         .         .         .:280
query           LSFEEDLGKRDWAAWLRxxxx
2z7bA           VGAQIDRGWNHWSQRLR----
1e48P           ---------------------
1dzzP           ---------------------
1dzvP           ---------------------
1e4cP           ---------------------
1e46P           ---------------------
2fuaA           ---------------------
1fuaA           ---------------------
1e47P           ---------------------
1dzxP           ---------------------
1e4bP           ---------------------
1dzwP           ---------------------
1e49P           ---------------------
1dzuP           ---------------------
1e4aP           ---------------------
2flfH           ---------------------
2flfG           ---------------------
2flfF           ---------------------
2flfE           ---------------------
2flfB           ---------------------
2flfA           ---------------------
2fk5B           ---------------------
2fk5A           ---------------------
2flfC           ---------------------
2irpB           ---------------------
2irpA           ---------------------
1k0wA           ---------------------
1jdiA           ---------------------
2opiB           ---------------------
2opiA           ---------------------