[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rcon0:AAL03501.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2od0B.bssp"
#ERROR : Can't open dsspfile "2od0A.bssp"

## Summary of PDB Search
:94
    4e-05  29%  2od0B  [x.x.x] HYPOTHETICAL PROTEIN VP1028
    4e-05  29%  2od0A  [x.x.x] HYPOTHETICAL PROTEIN VP1028
:94

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxELLEPYGSVVVRVMFGGYGIYKGGVMIGIIKSNELYFKSDLSTYEYFQSFGSESFVYQS
2od0B           -----------KLFEALGTIKSR-SFGGFGLFADETF-ALVVNNQLHIRADQQTSSDFETQGLKPYVYKK
2od0A           -----------KLFEALGTIKSR-SFGGFGLFADETF-ALVVNNQLHIRADQQTSSDFETQGLKPYVYKK


                         .         .         *         .         .         .         .:140
query           KGKLVTLKxxxxxxxxxxxxxxxx
2od0B           RGFPVVTK----------------
2od0A           RGFPVVTK----------------