[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rcon0:thdF

[Show Plain Result]

#ERROR : Can't open dsspfile "1xzpA.bssp"
#ERROR : Can't open dsspfile "1xzqA.bssp"
#ERROR : Can't open dsspfile "1rflA.bssp"
#ERROR : Can't open dsspfile "2gjaB.bssp"
#ERROR : Can't open dsspfile "2gjaA.bssp"
#ERROR : Can't open dsspfile "2gj9A.bssp"
#ERROR : Can't open dsspfile "2gj9B.bssp"
#ERROR : Can't open dsspfile "2gj8D.bssp"
#ERROR : Can't open dsspfile "2gj8B.bssp"
#ERROR : Can't open dsspfile "2gj8A.bssp"
#ERROR : Can't open dsspfile "1xzqB.bssp"
#ERROR : Can't open dsspfile "1xzpB.bssp"
#ERROR : Can't open dsspfile "3ievA.bssp"
#ERROR : Can't open dsspfile "1egaB.bssp"
#ERROR : Can't open dsspfile "1egaA.bssp"
#ERROR : Can't open dsspfile "1mkyA.bssp"
#ERROR : Can't open dsspfile "1wf3A.bssp"
#ERROR : Can't open dsspfile "2wjjB.bssp"
#ERROR : Can't open dsspfile "2wjjA.bssp"
#ERROR : Can't open dsspfile "2wjhA.bssp"
#ERROR : Can't open dsspfile "2wjgB.bssp"
#ERROR : Can't open dsspfile "2wjgA.bssp"
#ERROR : Can't open dsspfile "3a1wA.bssp"
#ERROR : Can't open dsspfile "3a1vA.bssp"
#ERROR : Can't open dsspfile "3a1uA.bssp"
#ERROR : Can't open dsspfile "3a1tA.bssp"
#ERROR : Can't open dsspfile "3a1sB.bssp"
#ERROR : Can't open dsspfile "3a1sA.bssp"
#ERROR : Can't open dsspfile "2hjgA.bssp"
#ERROR : Can't open dsspfile "2dykA.bssp"
#ERROR : Can't open dsspfile "3ec1A.bssp"
#ERROR : Can't open dsspfile "3i8xA.bssp"
#ERROR : Can't open dsspfile "3i8sA.bssp"
#ERROR : Can't open dsspfile "3i92A.bssp"

## Summary of PDB Search
:445
    2e-53  33%  1xzpA  [d.250.1 - a.24.25 - c.37.1] PROBABLE TRNA MODIFICATION
    8e-53  33%  1xzqA  [d.250.1 - a.24.25 - c.37.1] PROBABLE TRNA MODIFICATION
    2e-22  50%  1rflA  [c.37.1] PROBABLE TRNA MODIFICATION GTPASE TRME
    3e-20  49%  2gjaB  [x.x.x] TRNA MODIFICATION GTPASE TRME
    3e-20  49%  2gjaA  [x.x.x] TRNA MODIFICATION GTPASE TRME
    3e-20  49%  2gj9A  [x.x.x] TRNA MODIFICATION GTPASE TRME
    2e-19  49%  2gj9B  [x.x.x] TRNA MODIFICATION GTPASE TRME
    3e-17  49%  2gj8D  [x.x.x] TRNA MODIFICATION GTPASE TRME
    3e-17  49%  2gj8B  [x.x.x] TRNA MODIFICATION GTPASE TRME
    3e-17  49%  2gj8A  [x.x.x] TRNA MODIFICATION GTPASE TRME
    3e-14  39%  1xzqB  [d.250.1] PROBABLE TRNA MODIFICATION GTPASE TRME
    3e-14  39%  1xzpB  [d.250.1] PROBABLE TRNA MODIFICATION GTPASE TRME
    3e-11  43%  3ievA  [x.x.x] GTP-BINDING PROTEIN ERA
    5e-11  44%  1egaB  [c.37.1 - d.52.3] PROTEIN (GTP-BINDING PROTEIN ERA)
    5e-11  44%  1egaA  [c.37.1 - d.52.3] PROTEIN (GTP-BINDING PROTEIN ERA)
    2e-09  32%  1mkyA  [c.37.1 - c.37.1 - d.52.5] PROBABLE GTP-BINDING PROTEIN ENGA
    4e-07  43%  1wf3A  [c.37.1 - d.52.3] GTP-BINDING PROTEIN
    3e-05  30%  2wjjB  [x.x.x] FERROUS IRON TRANSPORT PROTEIN B HOMOLOG
    3e-05  30%  2wjjA  [x.x.x] FERROUS IRON TRANSPORT PROTEIN B HOMOLOG
    3e-05  30%  2wjhA  [x.x.x] FERROUS IRON TRANSPORT PROTEIN B HOMOLOG
    3e-05  30%  2wjgB  [x.x.x] FERROUS IRON TRANSPORT PROTEIN B HOMOLOG
    3e-05  30%  2wjgA  [x.x.x] FERROUS IRON TRANSPORT PROTEIN B HOMOLOG
    7e-05  35%  3a1wA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    7e-05  35%  3a1vA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    7e-05  35%  3a1uA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    7e-05  35%  3a1tA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    7e-05  35%  3a1sB  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    7e-05  35%  3a1sA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    3e-04  29%  2hjgA  [x.x.x] GTP-BINDING PROTEIN ENGA
    3e-04  43%  2dykA  [x.x.x] GTP-BINDING PROTEIN
    6e-04  40%  3ec1A  [x.x.x] YQEH GTPASE
    7e-04  33%  3i8xA  [x.x.x] FERROUS IRON TRANSPORT PROTEIN B
    7e-04  34%  3i8sA  [x.x.x] FERROUS IRON TRANSPORT PROTEIN B
    0.001  34%  3i92A  [x.x.x] FERROUS IRON TRANSPORT PROTEIN B
:445

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           METIFAQSSAFGKAGVAVFRISGPKSLEVLQLLTGRKDFKSRLMYYQQITVPETKELIDNVMVVYFKSPG
1xzpA           MDTIVAVATPPGKGAIAILRLSGPDSWKIVQKLRTRSKIVPRKAIHGWIH--ENGXXXXXXXXXFYKSPK
1xzqA           -DTIVAVATPPGKGAIAILRLSGPDSWKIVQKLRTRSKIVPRKAIHGWIH--ENGXXXXXXXXXFYKSPK
1rflA           ----------------------------------------------------------------------
2gjaB           ----------------------------------------------------------------------
2gjaA           ----------------------------------------------------------------------
2gj9A           ----------------------------------------------------------------------
2gj9B           ----------------------------------------------------------------------
2gj8D           ----------------------------------------------------------------------
2gj8B           ----------------------------------------------------------------------
2gj8A           ----------------------------------------------------------------------
1xzqB           MDTIVAVATPPGKGAIAILRLSGPDSWKIVQKLRTRSKIVPRKAIHGWIH--ENGXXXXXXXXXFYKSPK
1xzpB           MDTIVAVATPPGKGAIAILRLSGPDSWKIVQKLRTRSKIVPRKAIHGWIH--ENGXXXXXXXXXFYKSPK
3ievA           ----------------------------------------------------------------------
1egaB           ----------------------------------------------------------------------
1egaA           ----------------------------------------------------------------------
1mkyA           ----------------------------------------------------------------------
1wf3A           ----------------------------------------------------------------------
2wjjB           ----------------------------------------------------------------------
2wjjA           ----------------------------------------------------------------------
2wjhA           ----------------------------------------------------------------------
2wjgB           ----------------------------------------------------------------------
2wjgA           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
3a1vA           ----------------------------------------------------------------------
3a1uA           ----------------------------------------------------------------------
3a1tA           ----------------------------------------------------------------------
3a1sB           ----------------------------------------------------------------------
3a1sA           ----------------------------------------------------------------------
2hjgA           ----------------------------------------------------------------------
2dykA           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3i8xA           ----------------------------------------------------------------------
3i8sA           ----------------------------------------------------------------------
3i92A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SFTGEDVVEIHTHGSKAISIMLTNALLNIAGIRLAEAGEFTKRAFLNNKFDLTAAEGIADLINAETIMQH
1xzpA           SYTGEDMVEVMCHGGPXXXXXXXXXXXX-SGARMAEPGEFTKRAFLNGKMDLTSAEAVRDLIEAKSETSL
1xzqA           SYTGEDMVEVMCHGGPXXXXXXXXXXXX-SGARMAEPGEFTKRAFLNGKMDLTSAEAVRDLIEAKSETSL
1rflA           ----------------------------------------------------------------------
2gjaB           ----------------------------------------------------------------------
2gjaA           ----------------------------------------------------------------------
2gj9A           ----------------------------------------------------------------------
2gj9B           ----------------------------------------------------------------------
2gj8D           ----------------------------------------------------------------------
2gj8B           ----------------------------------------------------------------------
2gj8A           ----------------------------------------------------------------------
1xzqB           SYTGEDMVEVMCHGGPXXXXXXXXXXXX-SGARMAEPGEFTKRAFLNGK---------------------
1xzpB           SYTGEDMVEVMCHGGPXXXXXXXXXXXX-SGARMAEPGEFTKRAFLNGK---------------------
3ievA           ----------------------------------------------------------------------
1egaB           ----------------------------------------------------------------------
1egaA           ----------------------------------------------------------------------
1mkyA           ----------------------------------------------------------------------
1wf3A           ----------------------------------------------------------------------
2wjjB           ----------------------------------------------------------------------
2wjjA           ----------------------------------------------------------------------
2wjhA           ----------------------------------------------------------------------
2wjgB           ----------------------------------------------------------------------
2wjgA           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
3a1vA           ----------------------------------------------------------------------
3a1uA           ----------------------------------------------------------------------
3a1tA           ----------------------------------------------------------------------
3a1sB           ----------------------------------------------------------------------
3a1sA           ----------------------------------------------------------------------
2hjgA           ----------------------------------------------------------------------
2dykA           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3i8xA           ----------------------------------------------------------------------
3i8sA           ----------------------------------------------------------------------
3i92A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KQAIRQASGKLEALYNNWRSQLLKMLSLLEAYIDFPDEDIPDTVLNEVTNTHTILVNTISEYLNDNRKGE
1xzpA           KLSLRNLKGGLRDFVDSLRRELIEVLAEIRVELDYPDEI--ETNTGEVVTRLERIKEKLTEELKKADAGI
1xzqA           KLSLRNLKGGLRDFVDSLRRELIEVLAEIRVELDYPDEI--ETNTGEVVTRLERIKEKLTEELKKADAGI
1rflA           --------------------------------------------------------------------GS
2gjaB           ----------------------------------------------------------------------
2gjaA           ----------------------------------------------------------------------
2gj9A           ----------------------------------------------------------------------
2gj9B           ----------------------------------------------------------------------
2gj8D           ----------------------------------------------------------------------
2gj8B           ----------------------------------------------------------------------
2gj8A           ----------------------------------------------------------------------
1xzqB           ----------------------------------------------------------------------
1xzpB           ----------------------------------------------------------------------
3ievA           ----------------------------------------------------------------------
1egaB           ----------------------------------------------------------------------
1egaA           ----------------------------------------------------------------------
1mkyA           -------------------------------------EPIPVSAEHNINDTLETIIKKLEEKGLDLESKP
1wf3A           ----------------------------------------------------------------------
2wjjB           ----------------------------------------------------------------------
2wjjA           ----------------------------------------------------------------------
2wjhA           ----------------------------------------------------------------------
2wjgB           ----------------------------------------------------------------------
2wjgA           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
3a1vA           ----------------------------------------------------------------------
3a1uA           ----------------------------------------------------------------------
3a1tA           ----------------------------------------------------------------------
3a1sB           ----------------------------------------------------------------------
3a1sA           ----------------------------------------------------------------------
2hjgA           ----------------------------------------------------------------------
2dykA           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3i8xA           ----------------------------------------------------------------------
3i8sA           ----------------------------------------------------------------------
3i92A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LLRSGLKLAIIGPPNVGKSSLLNFLMQRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIREESSDI
1xzpA           LLNRGLRMVIVGKPNVGKSTLLNRLLNEDRAIVTDIPGTTRDVISEEIVIRGILFRIVDTAGVRSETNDL
1xzqA           LLNRGLRMVIVGKPNVGKSTLLNRLLNEDRAIVTDIPGTTRDVISEEIVIRGILFRIVDTAGVRSETNDL
1rflA           LLREGMKVVIAGRPNAGKSSLLNALAGREAAIVTDIAGTTRDVLREHIHIDGMPLHIIDTAGLR-EASDE
2gjaB           ----GMKVVIAGRPNAGKSSLLNALAGREAAIVTDIAGTTRDVLREHIHIDGMPLHIIDTAGLR-EASDE
2gjaA           ----GMKVVIAGRPNAGKSSLLNALAGREAAIVTDIAGTTRDVLREHIHIDGMPLHIIDTAGLR-EASDE
2gj9A           ----GMKVVIAGRPNAGKSSLLNALAGREAAIVTDIAGTTRDVLREHIHIDGMPLHIIDTAGLR-EASDE
2gj9B           -----MKVVIAGRPNAGKSSLLNALAGREAAIVTDIAGTTRDVLREHIHIDGMPLHIIDTAGLR-EASDE
2gj8D           ------KVVIAGRPNAGKSSLLNALAGREAAIVTDIAGTTRDVLREHIHIDG-PLHIIDTAGLR-EASDE
2gj8B           ------KVVIAGRPNAGKSSLLNALAGREAAIVTDIAGTTRDVLREHIHIDG-PLHIIDTAGLR-EASDE
2gj8A           ------KVVIAGRPNAGKSSLLNALAGREAAIVTDIAGTTRDVLREHIHIDG-PLHIIDTAGLR-EASDE
1xzqB           ----------------------------------------------------------------------
1xzpB           ----------------------------------------------------------------------
3ievA           -------VAIVGKPNVGKSTLLNNLLGTKVSIISPKAGTTRMRVLGVKNINEAQIIFLDTPGIYEKKSDV
1egaB           -------IAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRHRIVGIHTEGAYQAIYVDTPGLHME----
1egaA           -------IAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRHRIVGIHTEGAYQAIYVDTPGLHME----
1mkyA           EITDAIKVAIVGRPNVGKSTLFNAILNKERALVSPIP------VDDEVFIDGRKYVFVDTAGLEKYSN--
1wf3A           -------VAIVGKPNVGKSTLLNNLLGVKVAPISPRPQTTRKRLRGILTEGRRQIVFVDTPGLHK-----
2wjjB           ------EIALIGNPNVGKSTIFNALTGENV-YIGNWPGVTVEKKEGEFEYNGEKFKVVDLPGVYSLTANS
2wjjA           ------EIALIGNPNVGKSTIFNALTGENV-YIGNWPGVTVEKKEGEFEYNGEKFKVVDLPGVYSLTANS
2wjhA           ------EIALIGNPNVGKSTIFNALTGENV-YIGNWPGVTVEKKEGEFEYNGEKFKVVDLPGVYSLTANS
2wjgB           ------EIALIGNPNVGKSTIFNALTGENV-YIGNWPGVTVEKKEGEFEYNGEKFKVVDLPGVYSLTANS
2wjgA           ------EIALIGNPNVGKSTIFNALTGENV-YIGNWPGVTVEKKEGEFEYNGEKFKVVDLPGVYSLTANS
3a1wA           -----VKVALAGCPNVGKTSLFNALTGTK-QYVANWPGVTVEKKEGVFTYKGYTINLIDLPGTYSLGYSS
3a1vA           -----VKVALAGCPNVGKTSLFNALTGTK-QYVANWPGVTVEKKEGVFTYKGYTINLIDLPGTYSLGYSS
3a1uA           -----VKVALAGCPNVGKTSLFNALTGTK-QYVANWPGVTVEKKEGVFTYKGYTINLIDLPGTYSLGYSS
3a1tA           -----VKVALAGCPNVGKTSLFNALTGTK-QYVANWPGVTVEKKEGVFTYKGYTINLIDLPGTYSLGYSS
3a1sB           -----VKVALAGCPNVGKTSLFNALTGTK-QYVANWPGVTVEKKEGVFTYKGYTINLIDLPGTYSLGYSS
3a1sA           -----VKVALAGCPNVGKTSLFNALTGTK-QYVANWPGVTVEKKEGVFTYKGYTINLIDLPGTYSLGYSS
2hjgA           -----IQFCLIGRPNVGKSSLVNALGEERV-IVS---------VDTSFTYNQQEFVIVDTAGRKKKVYET
2dykA           ------KVVIVGRPNVGKSSLFNRLLKK-----------RSDLKEGVVETDRGRFLLVDTGGL--WSGDK
3ec1A           --REGGDVYVVGCTNVGKSTFINRIIEENVITTSYFPGTTLDMIEIPLESGA---TLYDTPGI-------
3i8xA           -----LTIGLIGNPNSGKTTLFNQLRQR----VGNWAGVTVERKEGQFSTTDHQVTLVDLPGTYSLTTQT
3i8sA           -----LTIGLIGNPNSGKTTLFNQLRQR----VGNWAGVTVERKEGQFSTTDHQVTLVDLPGTYSLTTTS
3i92A           -----LTIGLIGNPNSGKTTLFNQLRQR----VGNWAGVTVERKEGQFSTTDHQVTLVDLPGTYSLTQTS


                         .         *         .         .         .         .         +:350
query           IEQEGIKRAINSAKTADIKIIMFDAEKLDSSXXXXXXXXXXXXXXXXXXKIDLIEASKIFSIENKYKCLR
1xzpA           VERLGIERTLQEIEKADIVLFVLDASSLDEELERIKNKRYLVVIXXXXXXXXXXXXXXXXXLGTDRHMVK
1xzqA           VERLGIERTLQEIEKADIVLFVLDASSLDEELERIKNKRYLVVIXXXXXXXXXXXXXXXXXLGTDRHMVK
1rflA           VERIGIERAWQEIEQADRVLFMVDGTTTDA----------------------------------------
2gjaB           VERIGIERAWQEIEQADRVLFMVDGTTTDA----------------------------------------
2gjaA           VERIGIERAWQEIEQADRVLFMVDGTTTDA----------------------------------------
2gj9A           VERIGIERAWQEIEQADRVLFMVDGTTTDA----------------------------------------
2gj9B           VERIGIERAWQEIEQADRVLFMVDGTTTDA----------------------------------------
2gj8D           VERIGIERAWQEIEQAD-RVLFVDGTTTDA----------------------------------------
2gj8B           VERIGIERAWQEIEQAD-RVLFVDGTTTDA----------------------------------------
2gj8A           VERIGIERAWQEIEQAD-RVLFVDGTTTDA----------------------------------------
1xzqB           ----------------------------------------------------------------------
1xzpB           ----------------------------------------------------------------------
3ievA           LGHSMVEIAKQSLEEADVILFMIDA---------------------------------------------
1egaB           -EKRAINRLMNKAASSDVELVIFVVE--------------------------------------------
1egaA           -EKRAINRLMNKAASSDVELVIFVVE--------------------------------------------
1mkyA           ------YRVVDSIEKADVVVIVLDA---------------------------------------------
1wf3A           ----------------------------------------------------------------------
2wjjB           ID-EIIARDYIINEKPDLVVNIVDATALE-----------------------------------------
2wjjA           ID-EIIARDYIINEKPDLVVNIVDATALE-----------------------------------------
2wjhA           ID-EIIARDYIINEKPDLVVNIVDATALE-----------------------------------------
2wjgB           ID-EIIARDYIINEKPDLVVNIVDATALE-----------------------------------------
2wjgA           ID-EIIARDYIINEKPDLVVNIVDATALE-----------------------------------------
3a1wA           ID-EKIARDYLLKGDADLVILVADSVNPEQS---------------------------------------
3a1vA           ID-EKIARDYLLKGDADLVILVADSVNPEQS---------------------------------------
3a1uA           ID-EKIARDYLLKGDADLVILVADSVNPEQS---------------------------------------
3a1tA           ID-EKIARDYLLKGDADLVILVADSVNPEQS---------------------------------------
3a1sB           ID-EKIARDYLLKGDADLVILVADSVNPEQS---------------------------------------
3a1sA           ID-EKIARDYLLKGDADLVILVADSVNPEQS---------------------------------------
2hjgA           TEKYSVLRALKAIDRSEVVAVVLDGEE-------------------------------------------
2dykA           WEQEKVDRALEDAE--------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3i8xA           SLDEQIACHYILSGDADLLINVVDASNLE-----------------------------------------
3i8sA           LDEQIACHYILSG-DADLLINVVDASNLE-----------------------------------------
3i92A           LDEQIACHYILSG-DADLLINVVDASNLE-----------------------------------------


                         .         .         .         .         *         .         .:420
query           VSVKNNIALSSILKNIENIAENMAGFTETPYITNQRHRNYLQQALSHLTAFSLDNDLVLATEDIRMTARC
1xzpA           ISAXXXXXXXXXXXSIYRETQEIFERGSDSLITNLRQKQLLENVKGHLKSLKEGMPVDMASIDLERALNL
1xzqA           ISAXXXXXXXXXXXSIYRETQEIFERGSDSLITNLRQKQLLENVKGHLKSLKEGMPVDMASIDLERALNL
1rflA           ----------------------------------------------------------------------
2gjaB           ----------------------------------------------------------------------
2gjaA           ----------------------------------------------------------------------
2gj9A           ----------------------------------------------------------------------
2gj9B           ----------------------------------------------------------------------
2gj8D           ----------------------------------------------------------------------
2gj8B           ----------------------------------------------------------------------
2gj8A           ----------------------------------------------------------------------
1xzqB           ----------------------------------------------------------------------
1xzpB           ----------------------------------------------------------------------
3ievA           ----------------------------------------------------------------------
1egaB           ----------------------------------------------------------------------
1egaA           ----------------------------------------------------------------------
1mkyA           ----------------------------------------------------------------------
1wf3A           ----------------------------------------------------------------------
2wjjB           ----------------------------------------------------------------------
2wjjA           ----------------------------------------------------------------------
2wjhA           ----------------------------------------------------------------------
2wjgB           ----------------------------------------------------------------------
2wjgA           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
3a1vA           ----------------------------------------------------------------------
3a1uA           ----------------------------------------------------------------------
3a1tA           ----------------------------------------------------------------------
3a1sB           ----------------------------------------------------------------------
3a1sA           ----------------------------------------------------------------------
2hjgA           ----------------------------------------------------------------------
2dykA           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3i8xA           ----------------------------------------------------------------------
3i8sA           ----------------------------------------------------------------------
3i92A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           IGAITGVINVEEILGEIFKNFCIGK
1xzpA           LDEVTGRSFREDLLDTIFSNFCVGK
1xzqA           LDEVTGRSFREDLLDTIFSNFCVGK
1rflA           -------------------------
2gjaB           -------------------------
2gjaA           -------------------------
2gj9A           -------------------------
2gj9B           -------------------------
2gj8D           -------------------------
2gj8B           -------------------------
2gj8A           -------------------------
1xzqB           -------------------------
1xzpB           -------------------------
3ievA           -------------------------
1egaB           -------------------------
1egaA           -------------------------
1mkyA           -------------------------
1wf3A           -------------------------
2wjjB           -------------------------
2wjjA           -------------------------
2wjhA           -------------------------
2wjgB           -------------------------
2wjgA           -------------------------
3a1wA           -------------------------
3a1vA           -------------------------
3a1uA           -------------------------
3a1tA           -------------------------
3a1sB           -------------------------
3a1sA           -------------------------
2hjgA           -------------------------
2dykA           -------------------------
3ec1A           -------------------------
3i8xA           -------------------------
3i8sA           -------------------------
3i92A           -------------------------