[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rcon0:dnaE

[Show Plain Result]

#ERROR : Can't open dsspfile "3e0dA.bssp"
#ERROR : Can't open dsspfile "2hnhA.bssp"
#ERROR : Can't open dsspfile "2hpiA.bssp"
#ERROR : Can't open dsspfile "2hqaA.bssp"
#ERROR : Can't open dsspfile "3f2cA.bssp"
#ERROR : Can't open dsspfile "3f2bA.bssp"
#ERROR : Can't open dsspfile "2eb0B.bssp"
#ERROR : Can't open dsspfile "2eb0A.bssp"

## Summary of PDB Search
:1181
    e-172  39%  3e0dA  [x.x.x] DNA POLYMERASE III SUBUNIT ALPHA
    e-171  41%  2hnhA  [x.x.x] DNA POLYMERASE III ALPHA SUBUNIT
    e-169  39%  2hpiA  [x.x.x] DNA POLYMERASE III ALPHA SUBUNIT
    e-138  42%  2hqaA  [x.x.x] DNA POLYMERASE III ALPHA SUBUNIT
    1e-11  30%  3f2cA  [x.x.x] GEOBACILLUS KAUSTOPHILUS DNA POLC
    3e-11  29%  3f2bA  [x.x.x] DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN
    3e-04  26%  2eb0B  [x.x.x] MANGANESE-DEPENDENT INORGANIC PYROPHOSPHATASE
    3e-04  26%  2eb0A  [x.x.x] MANGANESE-DEPENDENT INORGANIC PYROPHOSPHATASE
:1181

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxPEFIHLRTQSSYSFLESALTIEKVVELASSNKMPAICLADKGNLFGSLEFALCAVKKGLQPIHGVILN
3e0dA           ---KFAHLHQHTQFSLLNGAAKLQDLLKWVKETEDPALAMTDHGNLFGAVEFYKKATAMGVKPIIGVAAE
2hnhA           --PRFVHLRVHSDYSMIDGLAKTAPLVKKAAALGMPALAITDFTNLCGLVKFYGAGHGAGIKPIVGADFN
2hpiA           ---KFAHLHQHTQFSLLDGAAKLQDLLKWVKETEDPALAMTDHGNLFGAVEFYKKATAMGVKPIIGVAAE
2hqaA           --PRFVHLRVHSDYSIDGLAKTAPLVKKAAALG--PALAITDFTNLCGLVKFYGAGHGAGIKPIVGADFN
3f2cA           -----LHLHTPMSQ--MDAVTSVTKLIEQAKKWGHPAIAVTDHAVVQSFPEAYSAAKKHGMKVIYGLEAN
3f2bA           -----LHLHTPMSQ--MDAVTSVTKLIEQAKKWGHPAIAVTDHAVVQSFPEAYSAAKKHGMKVIYGLEAN
2eb0B           ----------------------------------------------------------------------
2eb0A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IKYDIDIFAQILLIAKDETGYKNLLKLSSLTFTKNDRKICDHIDFEDLIEYQEGLIGLCCYTDGIVGKCL
3e0dA           SRFDRKRYFHLTLLAKDFTGYQNLVRLASRAYLEGFYEK-PRIDREILREHAQGLIALSGCLGAEIPQFI
2hnhA           VQCDLDELTHLTVLAANNTGYQNLTLLISKAYQRGYGAAGPIIDRDWLIELNEGLILLSGGRMGDVGRSL
2hpiA           SRFDRKRYFHLTLLAKDFTGYQNLVRLASRAYLEGFYEK-PRIDREILREHAQGLIALSGCLGAEIPQFI
2hqaA           VQCDLDELTHLTVLAANNTGYQNLTLLISKAYQRGYGAAGPIIDRDWLIELNEGLI-LLSGGRGDVGRSL
3f2cA           I---VDDPFHVTLLAQNETGLKNLFKLVSLSHIQYFHRV-PRIPRSVLVKHRDGLVGSGC------DKGE
3f2bA           I---VDDPFHVTLLAQNETGLKNLFKLVSLSHIQYFHRV-PRIPRSVLVKHRDGLVGSGC------DKGE
2eb0B           ----------------------------------------------------------------------
2eb0A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LARNEEQAMLFARKLQEILGDRFYFEIMRHELPEEQFIEDSYIRIAAELAIPLVATNKVLFSEKSMHDAH
3e0dA           LQDRLDLAEARLNEDLSIFGDRFFIEIQNHGLPEQKKVNQVLKEFARKYGLGMVATNNGHYVRKEDARAH
2hnhA           LRGNSALVDECVAFYEEHFPDRYFLELIRTGRPDEE----SYLHAAVELALPVVATNDVRFIDSSDFDAH
2hpiA           LQDRLDLAEARLNEDLSIFGDRFFIEIQNHGLPEQKKVNQVLKEFARKYGLGMVATNDGHYVRKEDARAH
2hqaA           LRGNSALVDECVAFYEEHFPDRYFLELIRTGRPDEE----SYLHAAVELALPVVATNDVRFIDSSDFDAH
3f2cA           LFDNVEDIARFYDFL-EVHPPDVYKPLVKDEEMIKNIIR-SIVALGEKLDIPVVATGNVHYLNPEDKIYR
3f2bA           LFDNVEDIARFYDFLEVHPPDVYKPLYVKDEEMIKNIIR-SIVALGEKLDIPVVATGNVHYLNPEDKIYR
2eb0B           ----------------------------------------------------------------------
2eb0A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DVLLCISAGVTKEYLDRKTVSENCYFKSPHEMIELFSDLPSAIQNTVNLRERCYFAAHANPPMLPNFATE
3e0dA           EVLLAIQSKTTLDDPERRFPCDEFYVKTPEEMRAMLPEAEEPFDNTVEIARMCDVDLPIGDKMIPRFPLG
2hnhA           EIRVAIHDGFTLDDPKRRNYSPQQYMRSEEEMCELFADIPEALANTVEIAKRCNVTVRLGEYFLPQFPTG
2hpiA           EVLLAIQSKTTLDDPERRFPCDEFYVKTPEEMRAMLPEAEEPFDNTVEIARMCDVDLPIGDKMIPRFPLG
2hqaA           EIRVAIHDGFTLDDPKRPRNYSPQQYRSEEEC-ELFADIPEALANTVEIAKRCNVTVRLGEYFLPQFPTG
3f2cA           KILIHSQGGANP--LNRHELPD-VYFRTTNEMLDCFSFL-------------------------------
3f2bA           KILIHSQGGANP--LNRHELPD-VYFRTTNEMLDCFSFL-------------------------------
2eb0B           ----------------------------------------------------------------------
2eb0A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           NISETDLIKKDAKEGLLARLATKFKSENIALENQEALKTEYFARLNYELDIICNMNFAGYFLIVSDFIKW
3e0dA           R-TEAQYLRELTFLGLLRRYPDRITEAFYXXXXEELRKREWTARALYELSVIERMGFPGYFLIVQDYINW
2hnhA           DMSTEDYLVKRAKEGLEERLAFLFPDEEERLKR----RPEYDERLETELQVINQMGFPGYFLIVMEFIQW
2hpiA           R-TEAQYLRELTFLGLLRRYPDRITEAFYXXXXEELRKREWTARALYELSVIERMGFPGYFLIVQDYINW
2hqaA           DSTEDYLVKR-AKEGLEERLAFLFPDEEERLKR----RPEYDERLETELQVI-NQGFPGYFLIV-EFIQW
3f2cA           ----------------------------------------------------------------------
3f2bA           ----------------------------------------------------------------------
2eb0B           ----------------------------------------------------------------------
2eb0A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           SKKEGILVGPGRGSGAGSVVAWSLLITDLDPIKFGLLFERFLNPERISMPDFDIDFCQERREEVINYVRS
3e0dA           ARGHGVSVGPGRGSAAGSLVAYAVGITNIDPLRFGLLFERFLNPERVSMPDIDTDFSDRERDRVIQYVRE
2hnhA           SKDNGVPVGPGRGSGAGSLVAYALKITXXXXXXXXXXXXXXXNPERVSMPDFDVDFCMEKRDQVIEHVAD
2hpiA           ARGHGVSVGPGRGSAAGSLVAYAVGITNIDPLRFGLLFERFLNPERVSMPDIDTDFSDRERDRVIQYVRE
2hqaA           SKDNGVPVGPGRGSGAGSLVAYALKITXXXXXXXXXXXXXXXNPERVS-PDFDVDFC-EKRDQVIEHV-A
3f2cA           ----------------------------------------------------------------------
3f2bA           ----------------------------------------------------------------------
2eb0B           ----------------------------------------------------------------------
2eb0A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           KYGNNRVGQIITFGKMQAKAVIKDVARVLSLPYKFADYLTELVPFSAVNPVSLEQAMREVPELANAAKGN
3e0dA           RYGEDKVAQIGTFGSLASKAALKDVARVYGIPHKKAEELAKLIPVQFGKPKPLQEAFEAEPELRAEME--
2hnhA           MYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDRISKLIPPDP--GMTLAKAFEAEPQLPE-----
2hpiA           RYGEDKVAQIGTFGSLASKAALKDVARVYGIPHKKAEELAKLIPVQFGKPKPLQEALRAEME--------
2hqaA           DYGRDAVSQIITFGTA-AKAVIRDVGRVLGHPYGFVDRISKLIP---PDPGTLAKAFEAEPQLPE-----
3f2cA           ----------------------------------------------------------------------
3f2bA           ----------------------------------------------------------------------
2eb0B           ----------------------------------------------------------------------
2eb0A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           GLYNLDGEAELIKLVIDTSLILEGLHRHSSTHAAGIVIAGTDLVDIVPVYKDANSDMLIVGYSMKYSEIA
3e0dA           -------KDERIRQVIEVAMRLEGLNRHASVHAAGVVIAAEPLTDLVPLMRD-QEGRPVTQYDMGAVEAL
2hnhA           -IYEADEE---VKALIDMARKLEGVTRNAGKHAGGVVIAPTKITDFAPLYCDEEGKHPVTQFDKSDVEYA
2hpiA           -------KDERIRQVIEVAMRLEGLNRHASVHAAGVVIAAEPLTDLVPLMRD-QEGRPVTQYDMGAVEAL
2hqaA           -IYEADEE---VKALIDARK-LEGVTRNAGKHAGGVVIAPTKITDFAPLYCDEEGKHPVTQFDKSDVEYA
3f2cA           ----------------------------------------------------------------------
3f2bA           ----------------------------------------------------------------------
2eb0B           --------------------LIGGKKKELKPDLAGLLLSA--IISDTVLFKSPTTTDLDKEMAKKLAEIA
2eb0A           --------------------LIGGKKKELKPDLAGLLLSA--IISDTVLFKSPTTTDLDKEMAKKLAEIA


                         .         .         .         *         .         .         .:630
query           GLIKFDFLGLQTLTVITDCKKLLKEQGIEVDFNNMTFDDNKTYQMLCKGKGVGVFQFESIGMKDALRRLK
3e0dA           GLLKMDFLGLRTLTFLDEARRIVKEKGVELDYDRLPLDDPKTFELLSRGETKGVFQLESGGMTATVRGLK
2hnhA           GLVKFDFLGLRTLTIINWALEMINKRRAKLDIAAIPLDDKKSFDMLQRSETTAVFQLESRGMKDLIKRLQ
2hpiA           GLLKMDFLGLRTLTFLDEARRIVKEKGVELDYDRLPLDDPKTFELLSRGETKGVFQLESGGMTATVRGLK
2hqaA           GLVKFDFLGLRTLTIINWAKRRAKNGEPPLDIAAIPLDDKKSFD-LQRSETTAVFQLESRG-KDLIKRLQ
3f2cA           ----------------------------------------------------------------------
3f2bA           ----------------------------------------------------------------------
2eb0B           GISNIEEFGMEILKAKSVVGKLKPEEIINMDFKNFDFN----------GKKVGIGQVEVIDVSEV--ESK
2eb0A           GISNIEEFGMEILKAKSVVGKLKPEEIINMDFKNFDFN----------GKKVGIGQVEVIDVSEV--ESK


                         .         +         .         .         .         .         *:700
query           PDSIHDLIALGALYRPGPMENIPTYIACKHKLQQPDYLHELLQPILEETYGVVIYQEQVQRIAQVLAGYT
3e0dA           PRRLEDIIALVSLYRPGPMEHIPTYIR-RHHGQEPPHAEKYLRPILDETYGIPVYQEQIMQIASQVAGYS
2hnhA           PDCFEDMIALVALFRPGPLQSVDNFIDRKHEISYPDWQHESLKPVLEPTYGIILYQEQVMQIAQVLSGYT
2hpiA           PRRLEDIIALVSLYRPGPMEHIPTYIR-RHHGQEPPHAEKYLRPILDETYGIPVYQEQIMQIASQVAGYS
2hqaA           PDCFED-IALVALFRPGPLQSVDNFIDRKHEISYPDWQHESLKPVLEPTYGIILYQEQVQ-IAQVLSGYT
3f2cA           ----------------------------------------------------------------------
3f2bA           ----------------------------------------------------------------------
2eb0B           KEDIYKLL--------------------------------------------------------------
2eb0A           KEDIYKLL--------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           LGAADLLRRAMGXXXXXXXXXXXXXXXXGAIANNISESQAKSIFATVAKFAGYGFNKAHAASYGVISYQT
3e0dA           LGEADLLRRAMGKKRVEEMQKHRERFVRGAKERGVPEEEANRLFDMLEAFANYGFNKSHAAAYSLLSYQT
2hnhA           LGGADMLRRAMGKKKPEEMAKQRSVFAEGAEKNGINAELAMKIFDLVEKFAGYGFNKSHSAAYALVSYQT
2hpiA           LGEADLLRRAMGKKRVEEMQKHRERFVRGAKERGVPEEEANRLFDMLEAFANYGFNKSHAAAYSLLSYQT
2hqaA           LGGADLRR---AGKKKPEEAKQRSVFAEGAEKNGINAELAK-IFDLVEKFAGYGFNKSHSAAYALVSYQT
3f2cA           ----------------------------------------------------------------------
3f2bA           ----------------------------------------------------------------------
2eb0B           ----------------------------------------------------------------------
2eb0A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           AYLKANYPAAFLVACLNLELNNHDKINLFLQEAKDNGIKIIAPNINISEGYFSVKFSDTVIPHSVKPVIP
3e0dA           AYVKAHYPVEFMAALLSVERHDSDKVAEYIRDARALGIPVLPPDVNRSGFDFKVVGEEILF---------
2hnhA           LWLKAHYPAEFMAAVMTADMDNTEKVVGLVDECWRMGLKILPPDINSGLYHFHVN-DDGEIVYGIGAI--
2hpiA           AYVKAHYPVEFMAALLSVERHDSDKVAEYIRDARALGIPVLPPDVNRSGFDFKVVGEEILF---------
2hqaA           LWLKAHYPAEFAAVTAD---DNTEKVVGLVDECW-RGLKILPPDINSGLYHFHVN-DDGEIVYGIGAI--
3f2cA           ----------------------------------------------------------------------
3f2bA           ----------------------------------------------------------------------
2eb0B           ----------------------------------------------------------------------
2eb0A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           RLDRGIQKISKDTVVKPRCDXXXXXXXXXXXXXXVTPNFGKLVTDERKARGAFKSITDFIERLPPKSINS
3e0dA           ----GLSAVKN-----------------------VGEMAARAILEERERGGPFKSLGDFLKRLPEQVVNK
2hnhA           ---KGVGEGPIEAII-----------------------------EARNKGGYFRELFDLCARTDTKKLNR
2hpiA           ----GLSAVKN-----------------------VGEMAARAILEERERGGPFKSLGDFLKRLPEQVVNK
2hqaA           ---KGVGEGPIEAII-----------------------------EARNKGGYFRELFDLCARTDTKKLNR
3f2cA           ----------------------------------------------------------------------
3f2bA           ----------------------------------------------------------------------
2eb0B           ----------------------------------------------------------------------
2eb0A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           KLLENLIKSGCFDELHDNRLQLLSSIPKLLSYSTAYHEEQESNQFSLIKVSSLSPTILVSSDYADKNTLA
3e0dA           RALESLVKAGALDAFGD-RARLLASLEPLLRWAAETRERGRSGLVGLFAEVEEPP--LVEASPLDEITML
2hnhA           RVLEKLIMSGAFDRLGPHRAALMNSL--------------------------------------------
2hpiA           RALESLVKAGALDAFGD-RARLLASLEPLLRWAAETRERGRSGLVGLFAEVEEPP--LVEASPLDEITML
2hqaA           RVLEKLI-SGAFDRLGPHRAALNS----------------------------------------------
3f2cA           ----------------------------------------------------------------------
3f2bA           ----------------------------------------------------------------------
2eb0B           ----------------------------------------------------------------------
2eb0A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           FYEFEAMGLFISNHPLTEYQEIFSRLNILNTADLHNNLPDGTNRVNLAGVIQKxxxxxxxxxxxxxxxxx
3e0dA           RYEKEALGIYVSGHPVLRYPGLVASCTIEELSEFVRELP-GKPKVLLSGMVEE-----------------
2hnhA           ----------------------------------------------------------------------
2hpiA           RYEKEALGIYVSGHPVLRYPGLVASCTIEELSEFVRELP-GKPKVLLSGMVEE-----------------
2hqaA           ----------------------------------------------------------------------
3f2cA           ----------------------------------------------------------------------
3f2bA           ----------------------------------------------------------------------
2eb0B           ----------------------------------------------------------------------
2eb0A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3e0dA           ----------------------------------------------------------------------
2hnhA           ----------------------------------------------------------------------
2hpiA           ----------------------------------------------------------------------
2hqaA           ----------------------------------------------------------------------
3f2cA           ----------------------------------------------------------------------
3f2bA           ----------------------------------------------------------------------
2eb0B           ----------------------------------------------------------------------
2eb0A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3e0dA           -------------------------------------------------------------
2hnhA           -------------------------------------------------------------
2hpiA           -------------------------------------------------------------
2hqaA           -------------------------------------------------------------
3f2cA           -------------------------------------------------------------
3f2bA           -------------------------------------------------------------
2eb0B           -------------------------------------------------------------
2eb0A           -------------------------------------------------------------