[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rcon0:AAL03816.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2qlcE.bssp"
#ERROR : Can't open dsspfile "2qlcD.bssp"
#ERROR : Can't open dsspfile "2qlcC.bssp"
#ERROR : Can't open dsspfile "2qlcB.bssp"
#ERROR : Can't open dsspfile "2qlcA.bssp"

## Summary of PDB Search
:122
    2e-14  34%  2qlcE  [x.x.x] DNA REPAIR PROTEIN RADC HOMOLOG
    2e-14  34%  2qlcD  [x.x.x] DNA REPAIR PROTEIN RADC HOMOLOG
    2e-14  34%  2qlcC  [x.x.x] DNA REPAIR PROTEIN RADC HOMOLOG
    2e-14  34%  2qlcB  [x.x.x] DNA REPAIR PROTEIN RADC HOMOLOG
    2e-14  34%  2qlcA  [x.x.x] DNA REPAIR PROTEIN RADC HOMOLOG
:122

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxDYLKVNMGNMRLEQFRILFLNKKNILIADEVLSQGTIDQAAVYPREIIKRAL
2qlcE           ------------------EYMKGRIPDETKEHLFVLFLSTKNQILRHETITIGTLTASLIHPREIFKAAI
2qlcD           ------------------EYMKGRIPDETKEHLFVLFLSTKNQILRHETITIGTLTASLIHPREIFKAAI
2qlcC           ------------------EYMKGRIPDETKEHLFVLFLSTKNQILRHETITIGTLTASLIHPREIFKAAI
2qlcB           ------------------EYMKGRIPDETKEHLFVLFLSTKNQILRHETITIGTLTASLIHPREIFKAAI
2qlcA           ------------------EYMKGRIPDETKEHLFVLFLSTKNQILRHETITIGTLTASLIHPREIFKAAI


                         .         .         *         .         .         .         .:140
query           FNEASSLILVHHHPSGSPEPSKANIHMTNKIVEKCQTINIIVLNxxxxxxxx
2qlcE           RESAHSIILVHNHPSGDVQPSNADKQVTSILKKAGDLLQIELLD--------
2qlcD           RESAHSIILVHNHPSGDVQPSNADKQVTSILKKAGDLLQIELLD--------
2qlcC           RESAHSIILVHNHPSGDVQPSNADKQVTSILKKAGDLLQIELLD--------
2qlcB           RESAHSIILVHNHPSGDVQPSNADKQVTSILKKAGDLLQIELLD--------
2qlcA           RESAHSIILVHNHPSGDVQPSNADKQVTSILKKAGDLLQIELLD--------