[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rcon0:AAL02981.1

[Show Plain Result]


## Summary of Sequence Search
    1::103
    1::103     2e-56 100%  103 aa  CYAY_RICCN RecName: Full=Protein cyaY;
    1::103     2e-56 100%  103 aa  CYAY_RICAE RecName: Full=Protein cyaY;
    1::103     6e-56  99%  103 aa  CYAY_RICRS RecName: Full=Protein cyaY;
    1::103     6e-56  99%  103 aa  CYAY_RICRO RecName: Full=Protein cyaY;
    1::103     5e-55  98%  103 aa  CYAY_RICPU RecName: Full=Protein cyaY;
    1::99      5e-51  93%  101 aa  CYAY_RICFE RecName: Full=Protein cyaY;
    1::99      5e-42  76%  104 aa  CYAY_RICPR RecName: Full=Protein cyaY;
    1::99      3e-41  75%  104 aa  CYAY_RICTY RecName: Full=Protein cyaY;
    1::96      4e-41  80%   96 aa  CYAY_RICBR RecName: Full=Protein cyaY;
    1::99      2e-40  78%  101 aa  CYAY_RICAH RecName: Full=Protein cyaY;
    1::93      5e-14  36%  106 aa  CYAY_ERWCH RecName: Full=Protein cyaY;
    1::93      1e-12  36%  106 aa  CYAY_YERPP RecName: Full=Protein cyaY;
    1::93      1e-12  36%  106 aa  CYAY_YERPN RecName: Full=Protein cyaY;
    1::93      1e-12  36%  106 aa  CYAY_YERPG RecName: Full=Protein cyaY;
    1::93      1e-12  36%  106 aa  CYAY_YERPE RecName: Full=Protein cyaY;
    1::93      1e-12  36%  106 aa  CYAY_YERPA RecName: Full=Protein cyaY;
    1::93      2e-12  36%  106 aa  CYAY_YERPY RecName: Full=Protein cyaY;
    2::96      2e-12  39%  105 aa  CYAY_PHOPR RecName: Full=Protein cyaY;
    1::90      2e-12  40%  102 aa  CYAY_PASMU RecName: Full=Protein cyaY;
    1::92      2e-12  37%  104 aa  CYAY_VIBVY RecName: Full=Protein cyaY;
    1::92      2e-12  37%  104 aa  CYAY_VIBVU RecName: Full=Protein cyaY;
    1::92      2e-12  38%  104 aa  CYAY_VIBHB RecName: Full=Protein cyaY;
    1::91      2e-12  36%  106 aa  CYAY_PHOLL RecName: Full=Protein cyaY;
    1::93      3e-12  36%  107 aa  CYAY_YERPS RecName: Full=Protein cyaY;
    1::93      3e-12  36%  107 aa  CYAY_YERPB RecName: Full=Protein cyaY;
    1::93      3e-12  36%  107 aa  CYAY_YERP3 RecName: Full=Protein cyaY;
   76::154     6e-12  41%  187 aa  FRDA_ARATH RecName: Full=Frataxin homolog;
    1::93      1e-11  35%  107 aa  CYAY_EDWI9 RecName: Full=Protein cyaY;
    1::92      1e-11  36%  104 aa  CYAY_VIBPA RecName: Full=Protein cyaY;
    1::78      2e-11  36%  106 aa  CYAY_SERP5 RecName: Full=Protein cyaY;
  101::166     2e-11  50%  174 aa  FRDA_YEAST RecName: Full=Frataxin homolog, mitochondrial;Contains: 
    1::92      2e-11  38%  104 aa  CYAY_VIBF1 RecName: Full=Protein cyaY;
   42::149     3e-11  40%  158 aa  FRDA_SCHPO RecName: Full=Frataxin homolog, mitochondrial;Flags:
    1::92      3e-11  37%  104 aa  CYAY_ALISL RecName: Full=Protein cyaY;
    1::93      4e-11  34%  106 aa  CYAY_YERE8 RecName: Full=Protein cyaY;
    1::92      4e-11  37%  104 aa  CYAY_VIBFM RecName: Full=Protein cyaY;
    1::92      4e-11  32%  106 aa  CYAY_ERWCT RecName: Full=Protein cyaY;
   87::194     5e-11  38%  207 aa  FRDA_MOUSE RecName: Full=Frataxin, mitochondrial;       
    1::84      5e-11  35%  106 aa  CYAY_SALPC RecName: Full=Protein cyaY;
    1::84      5e-11  35%  106 aa  CYAY_SALCH RecName: Full=Protein cyaY;
    1::97      7e-11  35%  107 aa  CYAY_SHEON RecName: Full=Protein cyaY;
    1::93      7e-11  33%  106 aa  CYAY_SALAR RecName: Full=Protein cyaY;
    1::78      7e-11  35%  106 aa  CYAY_ENTS8 RecName: Full=Protein cyaY;
    1::90      7e-11  38%  101 aa  CYAY_ACTPJ RecName: Full=Protein cyaY;
    1::90      7e-11  38%  101 aa  CYAY_ACTP2 RecName: Full=Protein cyaY;
    1::84      9e-11  34%  106 aa  CYAY_SALA4 RecName: Full=Protein cyaY;
    1::91      9e-11  38%  105 aa  CYAY_BURP8 RecName: Full=Protein cyaY;
    3::99      2e-10  34%  109 aa  CYAY_SHESW RecName: Full=Protein cyaY;
    3::99      2e-10  34%  109 aa  CYAY_SHEPC RecName: Full=Protein cyaY;
    1::78      2e-10  34%  106 aa  CYAY_ESCF3 RecName: Full=Protein cyaY;
    3::99      2e-10  34%  109 aa  CYAY_SHEB9 RecName: Full=Protein cyaY;
    3::99      2e-10  34%  109 aa  CYAY_SHEB8 RecName: Full=Protein cyaY;
    3::99      2e-10  34%  109 aa  CYAY_SHEB5 RecName: Full=Protein cyaY;
    1::84      2e-10  34%  106 aa  CYAY_SALNS RecName: Full=Protein cyaY;
    1::90      2e-10  36%  105 aa  CYAY_PSYIN RecName: Full=Protein cyaY;
    1::84      3e-10  33%  106 aa  CYAY_KLEP3 RecName: Full=Protein cyaY;
    1::90      3e-10  38%  101 aa  CYAY_ACTP7 RecName: Full=Protein cyaY;
    5::94      4e-10  33%  107 aa  CYAY_YERIN RecName: Full=Protein cyaY;
    3::99      4e-10  34%  109 aa  CYAY_SHESR RecName: Full=Protein cyaY;
    3::99      4e-10  34%  109 aa  CYAY_SHESM RecName: Full=Protein cyaY;
    3::99      4e-10  34%  109 aa  CYAY_SHESA RecName: Full=Protein cyaY;
    1::84      4e-10  34%  106 aa  CYAY_SALTY RecName: Full=Protein cyaY;
    1::84      4e-10  34%  106 aa  CYAY_SALTI RecName: Full=Protein cyaY;
    1::93      4e-10  32%  106 aa  CYAY_SALPB RecName: Full=Protein cyaY;
    1::84      4e-10  34%  106 aa  CYAY_SALG2 RecName: Full=Protein cyaY;
    1::84      4e-10  34%  106 aa  CYAY_SALEP RecName: Full=Protein cyaY;
    1::84      4e-10  34%  106 aa  CYAY_SALDC RecName: Full=Protein cyaY;
    1::78      4e-10  32%  106 aa  CYAY_KLEP7 RecName: Full=Protein cyaY;
   96::198     5e-10  39%  217 aa  FRDA_BOVIN RecName: Full=Frataxin, mitochondrial;       
    1::78      5e-10  34%  106 aa  CYAY_SALSV RecName: Full=Protein cyaY;
    1::93      5e-10  33%  106 aa  CYAY_SALPK RecName: Full=Protein cyaY;
    1::93      5e-10  33%  106 aa  CYAY_SALPA RecName: Full=Protein cyaY;
    1::92      5e-10  31%  106 aa  CYAY_PECCP RecName: Full=Protein cyaY;
    1::78      5e-10  32%  106 aa  CYAY_CITK8 RecName: Full=Protein cyaY;
    1::90      5e-10  36%  102 aa  CYAY_ACTSZ RecName: Full=Protein cyaY;
   90::197     8e-10  37%  210 aa  FRDA_MACFA RecName: Full=Frataxin, mitochondrial;       
    1::78      8e-10  32%  106 aa  CYAY_SHISS RecName: Full=Protein cyaY;
    1::78      8e-10  32%  106 aa  CYAY_SHIDS RecName: Full=Protein cyaY;
    1::78      8e-10  32%  106 aa  CYAY_SALHS RecName: Full=Protein cyaY;
    1::78      8e-10  32%  106 aa  CYAY_ECOSM RecName: Full=Protein cyaY;
    1::78      8e-10  32%  106 aa  CYAY_ECOSE RecName: Full=Protein cyaY;
    1::78      8e-10  32%  106 aa  CYAY_ECOLU RecName: Full=Protein cyaY;
    1::78      8e-10  32%  106 aa  CYAY_ECOLI RecName: Full=Protein cyaY;
    1::78      8e-10  32%  106 aa  CYAY_ECOLC RecName: Full=Protein cyaY;
    1::78      8e-10  32%  106 aa  CYAY_ECODH RecName: Full=Protein cyaY;
    1::78      8e-10  32%  106 aa  CYAY_ECOBW RecName: Full=Protein cyaY;
    1::78      8e-10  32%  106 aa  CYAY_ECO8A RecName: Full=Protein cyaY;
    1::78      8e-10  32%  106 aa  CYAY_ECO5E RecName: Full=Protein cyaY;
    1::78      8e-10  32%  106 aa  CYAY_ECO57 RecName: Full=Protein cyaY;
    1::78      8e-10  32%  106 aa  CYAY_ECO55 RecName: Full=Protein cyaY;
    1::78      8e-10  32%  106 aa  CYAY_ECO24 RecName: Full=Protein cyaY;
    1::78      1e-09  32%  106 aa  CYAY_ECO7I RecName: Full=Protein cyaY;
    1::78      2e-09  32%  106 aa  CYAY_SHIBS RecName: Full=Protein cyaY;
    1::78      2e-09  32%  106 aa  CYAY_SHIB3 RecName: Full=Protein cyaY;
    1::78      2e-09  32%  106 aa  CYAY_ECOUT RecName: Full=Protein cyaY;
    1::78      2e-09  32%  106 aa  CYAY_ECOL5 RecName: Full=Protein cyaY;
    1::78      2e-09  32%  106 aa  CYAY_ECOK1 RecName: Full=Protein cyaY;
    1::78      2e-09  32%  106 aa  CYAY_ECO81 RecName: Full=Protein cyaY;
    1::78      2e-09  32%  106 aa  CYAY_ECO45 RecName: Full=Protein cyaY;
    1::78      2e-09  32%  106 aa  CYAY_ECO27 RecName: Full=Protein cyaY;
    1::94      2e-09  32%  109 aa  CYAY_BURS3 RecName: Full=Protein cyaY;
  130::184     2e-09  52%  193 aa  FRDA_DICDI RecName: Full=Frataxin, mitochondrial;       
    1::78      2e-09  32%  106 aa  CYAY_ECOHS RecName: Full=Protein cyaY;
   24::120     3e-09  37%  136 aa  FRDA_CAEEL RecName: Full=Frataxin homolog;
    1::91      3e-09  35%  104 aa  CYAY_TOLAT RecName: Full=Protein cyaY;
    1::81      3e-09  36%  101 aa  CYAY_HAEIE RecName: Full=Protein cyaY;
    1::78      3e-09  31%  107 aa  CYAY_ENT38 RecName: Full=Protein cyaY;
   90::173     4e-09  40%  210 aa  FRDA_HUMAN RecName: Full=Frataxin, mitochondrial;AltName:
    1::81      5e-09  38%  102 aa  CYAY_MANSM RecName: Full=Protein cyaY;
    1::81      5e-09  35%  101 aa  CYAY_HAEIN RecName: Full=Protein cyaY;
    1::81      5e-09  35%  101 aa  CYAY_HAEIG RecName: Full=Protein cyaY;
    1::81      5e-09  35%  101 aa  CYAY_HAEI8 RecName: Full=Protein cyaY;
    1::94      7e-09  32%  108 aa  CYAY_BURM1 RecName: Full=Protein cyaY;
    1::94      7e-09  31%  108 aa  CYAY_BURCM RecName: Full=Protein cyaY;
    1::94      7e-09  31%  108 aa  CYAY_BURA4 RecName: Full=Protein cyaY;
   68::172     9e-09  34%  190 aa  FRDA_DROME RecName: Full=Frataxin homolog, mitochondrial;       
    1::81      9e-09  34%  102 aa  CYAY_HAES2 RecName: Full=Protein cyaY;
    1::81      9e-09  34%  102 aa  CYAY_HAES1 RecName: Full=Protein cyaY;
    1::96      1e-08  36%  112 aa  CYAY_JANMA RecName: Full=Protein cyaY;
    1::78      1e-08  31%  106 aa  CYAY_ECOL6 RecName: Full=Protein cyaY;
    2::95      1e-08  30%  107 aa  CYAY_NEIMB RecName: Full=Protein cyaY;
    1::96      1e-08  35%  112 aa  CYAY_HERAR RecName: Full=Protein cyaY;
    1::93      1e-08  31%  108 aa  CYAY_BURPS RecName: Full=Protein cyaY;
    1::93      1e-08  31%  108 aa  CYAY_BURP6 RecName: Full=Protein cyaY;
    1::93      1e-08  31%  108 aa  CYAY_BURP1 RecName: Full=Protein cyaY;
    1::93      1e-08  31%  108 aa  CYAY_BURP0 RecName: Full=Protein cyaY;
    1::93      1e-08  31%  108 aa  CYAY_BURMS RecName: Full=Protein cyaY;
    1::93      1e-08  31%  108 aa  CYAY_BURMA RecName: Full=Protein cyaY;
    1::93      1e-08  31%  108 aa  CYAY_BURM9 RecName: Full=Protein cyaY;
    1::93      1e-08  31%  108 aa  CYAY_BURM7 RecName: Full=Protein cyaY;
   34::92      3e-08  46%  104 aa  CYAY_VIBCM RecName: Full=Protein cyaY;
   34::92      3e-08  46%  104 aa  CYAY_VIBCH RecName: Full=Protein cyaY;
   34::92      3e-08  46%  104 aa  CYAY_VIBC3 RecName: Full=Protein cyaY;
    4::97      3e-08  31%  113 aa  CYAY_RALSO RecName: Full=Protein cyaY;
    2::95      7e-08  29%  107 aa  CYAY_NEIMF RecName: Full=Protein cyaY;
    2::95      7e-08  29%  107 aa  CYAY_NEIMA RecName: Full=Protein cyaY;
    2::95      7e-08  29%  107 aa  CYAY_NEIM0 RecName: Full=Protein cyaY;
    2::95      7e-08  29%  107 aa  CYAY_NEIG2 RecName: Full=Protein cyaY;
    2::95      7e-08  29%  107 aa  CYAY_NEIG1 RecName: Full=Protein cyaY;
   11::106     1e-07  26%  121 aa  CYAY_BUCAP RecName: Full=Protein cyaY;
    1::93      1e-07  32%  105 aa  CYAY_CHRVO RecName: Full=Protein cyaY;
    1::98      2e-07  35%  107 aa  CYAY_THISH RecName: Full=Protein cyaY;
    1::91      2e-07  30%  108 aa  CYAY_PSEA6 RecName: Full=Protein cyaY;
   26::94      3e-07  36%  108 aa  CYAY_BURCH RecName: Full=Protein cyaY;
   26::94      3e-07  36%  108 aa  CYAY_BURCC RecName: Full=Protein cyaY;
   26::94      3e-07  36%  108 aa  CYAY_BURCA RecName: Full=Protein cyaY;
    1::91      4e-07  33%  107 aa  CYAY_PSEHT RecName: Full=Protein cyaY;
   25::91      5e-07  34%  105 aa  CYAY_BURXL RecName: Full=Protein cyaY;
    1::85      5e-07  29%  109 aa  CYAY_BORA1 RecName: Full=Protein cyaY;
   26::94      6e-07  34%  108 aa  CYAY_BURVG RecName: Full=Protein cyaY;
   26::94      6e-07  34%  108 aa  CYAY_BURCJ RecName: Full=Protein cyaY;
   25::91      8e-07  35%  105 aa  CYAY_BURPP RecName: Full=Protein cyaY;
    1::85      8e-07  34%  109 aa  CYAY_BORPD RecName: Full=Protein cyaY;
    1::100     1e-06  29%  110 aa  CYAY_VARPS RecName: Full=Protein cyaY;
   25::106     1e-06  29%  116 aa  CYAY_BUCAT RecName: Full=Protein cyaY;
   25::106     1e-06  29%  116 aa  CYAY_BUCAI RecName: Full=Protein cyaY;
   25::106     1e-06  29%  116 aa  CYAY_BUCA5 RecName: Full=Protein cyaY;
   16::105     2e-06  28%  118 aa  FRDA_ENCCU RecName: Full=Frataxin, mitosomal;         Short=Fxn;
    1::78      2e-06  29%  106 aa  CYAY_SHIFL RecName: Full=Protein cyaY;
    1::87      2e-06  30%  112 aa  CYAY_DELAS RecName: Full=Protein cyaY;
    1::85      2e-06  32%  109 aa  CYAY_RHOFD RecName: Full=Protein cyaY;
    1::85      3e-06  31%  109 aa  CYAY_BORPA RecName: Full=Protein cyaY;
    1::85      3e-06  31%  109 aa  CYAY_BORBR RecName: Full=Protein cyaY;
    1::91      3e-06  30%  104 aa  CYAY_AERS4 RecName: Full=Protein cyaY;
    1::85      4e-06  31%  109 aa  CYAY_BORPE RecName: Full=Protein cyaY;
   15::76      5e-06  36%  110 aa  CYAY_PSEU5 RecName: Full=Protein cyaY;
    1::91      7e-06  30%  105 aa  CYAY_DECAR RecName: Full=Protein cyaY;
    1::96      1e-05  30%  110 aa  CYAY_ACIAC RecName: Full=Protein cyaY;
    1::92      2e-05  29%  104 aa  CYAY_VIBSL RecName: Full=Protein cyaY;
    1::78      2e-05  27%  106 aa  CYAY_SHIF8 RecName: Full=Protein cyaY;
   37::97      2e-05  32%  105 aa  CYAY_CHLT3 RecName: Full=Protein cyaY;
    1::91      2e-05  28%  104 aa  CYAY_AERHH RecName: Full=Protein cyaY;
   15::97      3e-05  26%  107 aa  FRDA_TRAHO RecName: Full=Frataxin;         Short=Fxn;
   23::102     3e-05  30%  106 aa  CYAY_COLP3 RecName: Full=Protein cyaY;
    1::80      3e-05  26%  116 aa  CYAY_POLSJ RecName: Full=Protein cyaY;
   12::101     3e-05  28%  118 aa  CYAY_BUCBP RecName: Full=Protein cyaY;
    3::77      1e-04  29%  110 aa  CYAY_PSEMY RecName: Full=Protein cyaY;
   33::93      1e-04  34%  108 aa  CYAY_BURTA RecName: Full=Protein cyaY;
   35::97      2e-04  30%  111 aa  CYAY_RALME RecName: Full=Protein cyaY;
    1::100     2e-04  27%  109 aa  CYAY_VEREI RecName: Full=Protein cyaY;
   41::97      7e-04  35%  111 aa  CYAY_RALEJ RecName: Full=Protein cyaY;
    1::103

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNNSEFSKIAETTIAYIAEKIEEQDKEASIDVDLQGDILNLDTDKGVYVINKQSAAKEIWLSSPVSGPYH
CYAY_RICCN      MNNSEFSKIAETTIAYIAEKIEEQDKEASIDVDLQGDILNLDTDKGVYVINKQSAAKEIWLSSPVSGPYH
CYAY_RICAE      MNNSEFSKIAETTIAYIAEKIEEQDKEASIDVDLQGDILNLDTDKGVYVINKQSAAKEIWLSSPVSGPYH
CYAY_RICRS      MNNSEFSKIAETTIAYIAEKIEEQDKEASIDVDLQGDILNLDTDKGVYVINKQSAAKEIWLSSPVSGPYH
CYAY_RICRO      MNNSEFSKIAETTIAYIAEKIEEQDKEASIDVDLQGDILNLDTDKGVYVINKQSAAKEIWLSSPVSGPYH
CYAY_RICPU      MNNSEFSKIAETTIAYIAEKIEEQDKEASIDVDLQGDILNLDTDKGVYVINKQSAAKEIWLSSPVSGPYH
CYAY_RICFE      MNNTEFSKIAETTIAYIADKIEEQDKEASIDVDLQGDILNLDTDKGIYVINKQSAAKEIWLSSPVSGPYH
CYAY_RICPR      MNNTAFSKLAETTIVYIVDKIEEQDLEGIIDVDLQGDILNLDTENGIYVINTQSASKEIWLSSPVSGPHH
CYAY_RICTY      MNNTAFSKLAETTIVYIVDKIEEQDIEGIIDVDLHGDILNLDTENGIYVINTQSASKEIWLSSPVSGPHH
CYAY_RICBR      MNNSEFSKIAETVIAHIADRIEEQNQD--IDVDLQSDILSIDTTDGIYVINKQSAAKEIWLSSPVSGPYH
CYAY_RICAH      MNNTEFSKXXXXXXXXXXXXXEEQDKEASIDVDLQGDILNLDTDKGIYVINKQSAAKEIWLSSPVSGPCH
CYAY_ERWCH      MNDSEFHQLADTLMLKVEETLDQFDGDADIDYETNGGVMTLSFENGKIVINRQEPMHQVWLATK-GGGYH
CYAY_YERPP      MNDSEFHQLADQLMLYIEETLDSFTGDSDIDYETNGGVMTLTFENGKIVINRQEPLHQVWLATKAGG-YH
CYAY_YERPN      MNDSEFHQLADQLMLYIEETLDSFTGDSDIDYETNGGVMTLTFENGKIVINRQEPLHQVWLATKAGG-YH
CYAY_YERPG      MNDSEFHQLADQLMLYIEETLDSFTGDSDIDYETNGGVMTLTFENGKIVINRQEPLHQVWLATKAGG-YH
CYAY_YERPE      MNDSEFHQLADQLMLYIEETLDSFTGDSDIDYETNGGVMTLTFENGKIVINRQEPLHQVWLATKAGG-YH
CYAY_YERPA      MNDSEFHQLADQLMLYIEETLDSFTGDSDIDYETNGGVMTLTFENGKIVINRQEPLHQVWLATKAGG-YH
CYAY_YERPY      MNDSEFHQLADQLMLYIEETLDGFTGDSDIDYETNGGVMTLTFENGKIVINRQEPLHQVWLATKAGG-YH
CYAY_PHOPR      MNDTEFHKLVDHALMIIEEGIDESG--ADIESETTGNVLTLEFERSQIVINRQEPLHELWLASK-SGGYH
CYAY_PASMU      MNVTEFHQNIEQVWAKIEEQLEAQD--CDVDCDTQGSVFSITQDRSQVVINKQEPLLELWLASRVGG-FH
CYAY_VIBVY      MNNTEFHQLVDNELQLIEEAIDESG--ADIDYETTGNVMTLEDDRSQIIINRQEPMQEIWLASK-SGGFH
CYAY_VIBVU      MNNTEFHQLVDNELQLIEEAIDESG--ADIDYETTGNVMTLEDDRSQIIINRQEPMQEIWLASK-SGGFH
CYAY_VIBHB      MNDTEFHQLVDAQMQLIEESID--DSGADIDYEVTGNVMTLEEDRSQIIINRQEPMHEIWLASK-SGGFH
CYAY_PHOLL      MNDSEFHQLADQLILYIEGQLDNYDGNADIDCETNGGVMTLSFDNSKIIINRQEPFHQIWLATK-GGGYH
CYAY_YERPS      MNDSEFHQLADQLMLYIEETLDGFTGDSDIDYETNGGVMTLTFENGKIVINRQEPLHQVWLATKAGG-YH
CYAY_YERPB      MNDSEFHQLADQLMLYIEETLDGFTGDSDIDYETNGGVMTLTFENGKIVINRQEPLHQVWLATKAGG-YH
CYAY_YERP3      MNDSEFHQLADQLMLYIEETLDGFTGDSDIDYETNGGVMTLTFENGKIVINRQEPLHQVWLATKAGG-YH
FRDA_ARATH      LQEEEFHKLANFTINHLLEKIEDYGDNVQIDIDYGNEVLTLKLGSGTYVLNKQTPNRQIWMSSPVSGPSR
CYAY_EDWI9      MNDSEFHLLADGLMQALEEALDACQSDADIDCETNGGVMTLSFENGKIVINRQEPLHQIWLATRAGG-YH
CYAY_VIBPA      MNDTEFHQLVDAQMQIIEESID--DSGADIDYEVSGNVMTLEEDRSQIIINRQEPMHEIWLASK-SGGFH
CYAY_SERP5      MNDSEFHQLADQLMLNIEETLDDFDGDADIDYETNGGVMTLSFENGTIVINRQEPLHQVWLATKTGG-YH
FRDA_YEAST      ------------------------------DVELSHGVMTLEIPAGTYVINKQPPNKQIWLASPLSGPNR
CYAY_VIBF1      MNNTEFHELVDEKLQLIEDMID--DSGADIEPVITGNVLTLEFERSQIVINKQEPMHEIWLASK-SGGFH
FRDA_SCHPO      LTDLEYHRVADDTLDVLNDTFEDLLEEVGKDYDIQGVITLMLGEKGTYVINKQPPAHQIWLSSPVSGPKH
CYAY_ALISL      MNNTEFHELVDAKLQLLEDMID--DSGADIEPIITGNVLTLEFERSQIVINKQEPMHEIWLASK-SGGFH
CYAY_YERE8      MNDSEFHQLADQLMLCIEETLDGFSGDSDIDYETNGGVMTLTFENGKIVINRQEPLHQVWLATKAGG-YH
CYAY_VIBFM      MNNTEFHELVDEKLQLLEDMID--DSGADIEPVITGNVLTLEFERSQIVINKQEPMHEIWLASK-SGGFH
CYAY_ERWCT      MNDSEFHQLADELMLQLEETLDQFEGDADIDSEINGGVMTLSFENGKIVINRQEPLHQIWLATKTGG-YH
FRDA_MOUSE      LDETAYERLAEETLDSLAEFFEDADKPYTLDYDVSGDTIKLGGDLGTYVINKQTPNKQIWLSSPSSGPKR
CYAY_SALPC      MNDSEFHRLADTLWLAIEERLDSWDGDSDIDCEINGGVLTLSFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_SALCH      MNDSEFHRLADTLWLAIEERLDSWDGDSDIDCEINGGVLTLSFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_SHEON      MTDTEFHQLADDMFQAIETAIETDEQDADVDIDASGNVLQLEVDGSKIVINKQEPLHEIWVATRFGG-YH
CYAY_SALAR      MNDSEFHRLADTLWLTIEERLDNWDGDSDIDCEINGGVLTLSFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_ENTS8      MNDSEFHRLADGLWMTIEERLDAWDGDSDIDCEINGGVLTLSFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_ACTPJ      MNVAEFHQKVEQVWQQIEEKID--DEALSIDTEIHGAVCTLTDDESQIIINKQEAMLELWLASKLGG-FH
CYAY_ACTP2      MNVAEFHQKVEQVWQQIEEKID--DEALSIDTEIHGAVCTLTDDESQIIINKQEAMLELWLASKLGG-FH
CYAY_SALA4      MNDSEFHRLADTLWLAIEERLDDWDGDSDIDCEINGGVLTISFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_BURP8      MSDSEYLTRAEAVLAAIERSLDDAD--ADIEFERSGNVLTLEFENGTKIINLQPPMQEIWIAAK-SGGYH
CYAY_SHESW      MTDTEFHQLADDMFQAIESAIETDEQDADVDIDASGNVLQLEVDGSKIVINKQEPLHEIWVATRFGG-YH
CYAY_SHEPC      MTDTEFHQLADDMFQAIESAIETDEQDADVDIDASGNVLQLEVDGSKIVINKQEPLHEIWVATRFGG-YH
CYAY_ESCF3      MNDSEFHRLADTLWLTIEERLDDWDGDSDIDCEINGGVLTITFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_SHEB9      ITDTEFHQLADDMFQAIENAIETDEQDADVDIDASGNVLQLEVDGSKIVINKQEPLHEIWVATRFGG-YH
CYAY_SHEB8      ITDTEFHQLADDMFQAIENAIETDEQDADVDIDASGNVLQLEVDGSKIVINKQEPLHEIWVATRFGG-YH
CYAY_SHEB5      ITDTEFHQLADDMFQAIENAIETDEQDADVDIDASGNVLQLEVDGSKIVINKQEPLHEIWVATRFGG-YH
CYAY_SALNS      MNDSEFHRLADALWLTIEERLDNWDGDSDIDCEINGGVLTLSFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_PSYIN      MNDSEFIQLADQLYQKIEEKIEESG--ADVDYDQNGSLLTLEFENHTLIINRQQPLHQVWLATLENG-HH
CYAY_KLEP3      MNDSEFHRLADSLWMTIEERLDDWDGDSDIDCEINGGVLTISFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_ACTP7      MNVAEFHQKVEQVWQQIEEKID--DEALSIDTEIHGAVCTLTDDESQIIINKQEAMLELWLASKLGG-FH
CYAY_YERIN      ---SEFHQLADQLMLYIEETLDGFSGDSDIDYETNGGVMTLTFENGSIVINRQEPLHQVWPATKAGG-YH
CYAY_SHESR      MTDTEFHQLADDMFQAIETAIETDEQDADVDIDASGNVLQLEVDGSKIVINKQEPLHEIWVATRFGG-YH
CYAY_SHESM      MTDTEFHQLADDMFQAIETAIETDEQDADVDIDASGNVLQLEVDGSKIVINKQEPLHEIWVATRFGG-YH
CYAY_SHESA      MTDTEFHQLADDMFQAIETAIETDEQDADVDIDASGNVLQLEVDGSKIVINKQEPLHEIWVATRFGG-YH
CYAY_SALTY      MNDSEFHRLADALWLTIEERLDSWDGDSDIDCEINGGVLTLSFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_SALTI      MNDSEFHRLADALWLTIEERLDNWDGDSDIDCEINGGVLTLSFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_SALPB      MNDSEFHRLADALWLTIEERLDSWDGDSDIDCEINGGVLTLSFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_SALG2      MNDSEFHRLADALWLTIEERLDNWDGDSDIDCEINGGVLTLSFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_SALEP      MNDSEFHRLADALWLTIEERLDNWDGDSDIDCEINGGVLTLSFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_SALDC      MNDSEFHRLADALWLTIEERLDNWDGDSDIDCEINGGVLTLSFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_KLEP7      MNDSEFHRLADSLWMTIEERLDDWDGDSDIDCEINGGVLTISFENGKIIINRQEPLHQVWLATK-QGGYH
FRDA_BOVIN      -----YERLAEETLDSLAEFFEDADKPYTFDVSFGSGVLTLGGDLGTYVINKQTPNKQIWLSSPSSGPKR
CYAY_SALSV      MNDSEFHRLADALWLTIEERLDSWDGDSDIDCEINGGVLTLSFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_SALPK      MNDSEFHRLADALWLTIEECLDSWDGDSDIDCEINGGVLTLSFENGKIIINRQEPLHQVWLATKQSG-YH
CYAY_SALPA      MNDSEFHRLADALWLTIEECLDSWDGDSDIDCEINGGVLTLSFENGKIIINRQEPLHQVWLATKQSG-YH
CYAY_PECCP      MNDSEFHQLADELMLQLEETLDRFEGDADIDYETNGGVMTLSFENGKIVINRQEPLHQIWLATKAGG-YH
CYAY_CITK8      MNDSEFHRLTDTLWMTIEERLDDWDGDSDIDCEINGGVLTITFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_ACTSZ      MNVAEFHQNIDQLWDSIEEQLEAQDADA--DCDRQGSVFTITDDRSQIVVNKQEPLLELWLASRLGG-LH
FRDA_MACFA      LDDTTYERLAEETLDSLAEFFEDADKPYTFDVSFGSGVLTLGGDLGTYVINKQTPNKQIWLSSPSSGPKR
CYAY_SHISS      MNDSEFHRLADQLWLTIEERLDDWDGDSDIDCEINGGVLTITFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_SHIDS      MNDSEFHRLADQLWLTIEERLDDWDGDSDIDCEINGGVLTITFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_SALHS      MNDSEFHRLADALWLTIEERLDNWDGDSDIDCEINGGVLTISFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_ECOSM      MNDSEFHRLADQLWLTIEERLDDWDGDSDIDCEINGGVLTITFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_ECOSE      MNDSEFHRLADQLWLTIEERLDDWDGDSDIDCEINGGVLTITFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_ECOLU      MNDSEFHRLADQLWLTIEERLDDWDGDSDIDCEINGGVLTITFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_ECOLI      MNDSEFHRLADQLWLTIEERLDDWDGDSDIDCEINGGVLTITFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_ECOLC      MNDSEFHRLADQLWLTIEERLDDWDGDSDIDCEINGGVLTITFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_ECODH      MNDSEFHRLADQLWLTIEERLDDWDGDSDIDCEINGGVLTITFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_ECOBW      MNDSEFHRLADQLWLTIEERLDDWDGDSDIDCEINGGVLTITFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_ECO8A      MNDSEFHRLADQLWLTIEERLDDWDGDSDIDCEINGGVLTITFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_ECO5E      MNDSEFHRLADQLWLTIEERLDDWDGDSDIDCEINGGVLTITFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_ECO57      MNDSEFHRLADQLWLTIEERLDDWDGDSDIDCEINGGVLTITFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_ECO55      MNDSEFHRLADQLWLTIEERLDDWDGDSDIDCEINGGVLTITFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_ECO24      MNDSEFHRLADQLWLTIEERLDDWDGDSDIDCEINGGVLTITFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_ECO7I      MNDSEFHRLADQLWLTIEERLDDWDGDSDIDCEINGGVLTITFENGKIIINRQEPLHQVWLATR-QGGYH
CYAY_SHIBS      MNDSEFHRLADQLWLTIEEHLDDWDGDSDIDCEINGGVLTITFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_SHIB3      MNDSEFHRLADQLWLTIEEHLDDWDGDSDIDCEINGGVLTITFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_ECOUT      MNDSEFHRLADQLWLTIEEHLDDWDGDSDIDCEINGGVLTITFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_ECOL5      MNDSEFHRLADQLWLTIEEHLDDWDGDSDIDCEINGGVLTITFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_ECOK1      MNDSEFHRLADQLWLTIEEHLDDWDGDSDIDCEINGGVLTITFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_ECO81      MNDSEFHRLADQLWLTIEEHLDDWDGDSDIDCEINGGVLTITFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_ECO45      MNDSEFHRLADQLWLTIEEHLDDWDGDSDIDCEINGGVLTITFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_ECO27      MNDSEFHRLADQLWLTIEEHLDDWDGDSDIDCEINGGVLTITFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_BURS3      MSDTEYLTRAEAVLAAVERTVDDNDGDHDIDLERNGSVLTLTFENGSKIINLQPPMKEVWIAAKAGG-FH
FRDA_DICDI      -------------------------------------------NKGTYVINKQTPNRQIWWSSPLSGPKR
CYAY_ECOHS      MNDSEFHRLADQLWLTIEERLDYWDGDSDIDCEINGGVLTITFENGKIIINRQEPLHQVWLATK-QGGYH
FRDA_CAEEL      ----EYETAADSTLERLSDYFDQIADSFPVDVSHAMGVLTVNVSKGTYVINKQSPNKQIWLSSPMSGPKR
CYAY_TOLAT      MKDSEFHALVEGRYQFIEQAIDNCDTD--IDCELNSGVVTLTFVNGSIIINKQEPLHQIWVATRENG-YH
CYAY_HAEIE      MNIAEFHQNIEHVWQKIEEELENQG--ADVDCETQGSVFTITFDNRTQVINKQEPLLELWIASKLGG-FH
CYAY_ENT38      MNDSEFHRLADNLWQTIEARLDDWDGDSDIDCEINGGVLTLSFENGKIIINRQEPLHQVWLATK-QGGYH
FRDA_HUMAN      LDETTYERLAEETLDSLAEFFEDADKPYTFDVSFGSGVLTLGGDLGTYVINKQTPNKQIWLSSPSSGPKR
CYAY_MANSM      MNIAEFHQNIDQIWDSIEEQLENQDIDA--DCERQGAVFTITFENRTQVINKQEPLLELWLASKLGG-FH
CYAY_HAEIN      MNIAEFHQNIEQVWQKIEEELENQG--ADVDCETQGSVFTITFDNRTQVINKQEPLLELWIASKLGG-FH
CYAY_HAEIG      MNIAEFHQNIEQVWQKIEEELENQG--ADVDCETQGSVFTITFDNRTQVINKQEPLLELWIASKLGG-FH
CYAY_HAEI8      MNIAEFHQNIEQVWQKIEEELENQG--ADVDCETQGSVFTITFDNRTQVINKQEPLLELWIASKLGG-FH
CYAY_BURM1      MSDTEYLTRAEAVLAAVERTVDANDGDHDIDLERNGSVLTLTFENGSKIINLQPPMKEVWIAAKAGG-FH
CYAY_BURCM      MSDTEYLARAEAVLASVERTVDANDGDHDIDLERNGSVLTLTFENGSIIINLQPPMKELWIAAKAGG-FH
CYAY_BURA4      MSDTEYLARAEAVLASVERTVDANDGDHDIDLERNGSVLTLTFENGSIIINLQPPMKELWIAAKAGG-FH
FRDA_DROME      LDGATYERVCSDTLDALCDYFEELTENASTDVAYSDGVLNLGGQHGTYVINRQTPNKQIWLSSPTSGPKR
CYAY_HAES2      MNIAEYHQNIEQVWLQIEEQLEEQG--CDVDCDTQGSVFTITADRSQIVVNKQEPLLELWLASKAGG-FH
CYAY_HAES1      MNIAEYHQNIEQVWLQIEEQLEEQG--CDVDCDTQGSVFTITADRSQIVVNKQEPLLELWLASKAGG-FH
CYAY_JANMA      MTESEFLKQAEATLDQIEASLEDLADTSDLDVECSGNVLEIEIDNGKIIVNSQAPMQELWVAAK-SGGFH
CYAY_ECOL6      MNDSEFHRLADQLWLTIEEHLDDWGGDSDIDCEINGGVLTITFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_NEIMB      MTESEFIRASEALFEHIEDQIDENGWD--FDCRFAGNVLTIEAGDGAQIINRHTPNQELWIAAK-SGGYH
CYAY_HERAR      MTESEFLKQAEATLDQIEATLEELANTSDLDVECSGNVLEIEIDNGTIIVNSQAPMQELWVAAK-SGGFH
CYAY_BURPS      MSDTDYLTRAEAVLAAVERSVDANDGDADIDLERNGSVLTLTFENGSKIINLQPPMKEVWIAAKAGG-FH
CYAY_BURP6      MSDTDYLTRAEAVLAAVERSVDANDGDADIDLERNGSVLTLTFENGSKIINLQPPMKEVWIAAKAGG-FH
CYAY_BURP1      MSDTDYLTRAEAVLAAVERSVDANDGDADIDLERNGSVLTLTFENGSKIINLQPPMKEVWIAAKAGG-FH
CYAY_BURP0      MSDTDYLTRAEAVLAAVERSVDANDGDADIDLERNGSVLTLTFENGSKIINLQPPMKEVWIAAKAGG-FH
CYAY_BURMS      MSDTDYLTRAEAVLAAVERSVDANDGDADIDLERNGSVLTLTFENGSKIINLQPPMKEVWIAAKAGG-FH
CYAY_BURMA      MSDTDYLTRAEAVLAAVERSVDANDGDADIDLERNGSVLTLTFENGSKIINLQPPMKEVWIAAKAGG-FH
CYAY_BURM9      MSDTDYLTRAEAVLAAVERSVDANDGDADIDLERNGSVLTLTFENGSKIINLQPPMKEVWIAAKAGG-FH
CYAY_BURM7      MSDTDYLTRAEAVLAAVERSVDANDGDADIDLERNGSVLTLTFENGSKIINLQPPMKEVWIAAKAGG-FH
CYAY_VIBCM      -----------------------------------GNVMTLEFDDGSQIINRQEPMREIWLASK-SGGYH
CYAY_VIBCH      -----------------------------------GNVMTLEFDDGSQIINRQEPMREIWLASK-SGGYH
CYAY_VIBC3      -----------------------------------GNVMTLEFDDGSQIINRQEPMREIWLASK-SGGYH
CYAY_RALSO      LTESEFLALADAELGRIERTVERAADEVDADIEIGGNVLTLEFDDGKIIINSQTPMQELWVAARAGG-FH
CYAY_NEIMF      MTESEFIRASEALFEHIEDQIDENGWD--FDCRFAGNVLTIEAGDGTQIINRHTPNQELWIAAK-SGGYH
CYAY_NEIMA      MTESEFIRASEALFEHIEDQIDENGWD--FDCRFAGNVLTIEAGDGTQIINRHTPNQELWIAAK-SGGYH
CYAY_NEIM0      MTESEFIRASEALFEHIEDQIDENGWD--FDCRFAGNVLTIEAGDGTQIINRHTPNQELWIAAK-SGGYH
CYAY_NEIG2      MTESEFIRASEALFEHIEDQIDENGWD--FDCRFAGNVLTIEAGDGTQIINRHTPNQELWIAAK-SGGYH
CYAY_NEIG1      MTESEFIRASEALFEHIEDQIDENGWD--FDCRFAGNVLTIEAGDGTQIINRHTPNQELWIAAK-SGGYH
CYAY_BUCAP      --NNNFYRLVDDLFLKIEDNLNFYDDKIDIDYEVQDYVMTITLNKSIIVVNKQESLRQIWLATKFNA-YH
CYAY_CHRVO      MTESEFLQLSDDIFDRIEQAIDEHGLDA--DTLRQGNVLEIEFDSGKVIVNRHAVNQEMWIAAK-SGGYH
CYAY_THISH      MADISFSLHAEQTLESLLERMSEFXXXXXXXXXXXXGVLTLEFDDGKLILNRQEAASQIWLASP-EGPAH
CYAY_PSEA6      MNDSQYHQLIDDLLINLEEMLD--DVEADIDYESASSILTLIFVNGSIIINKQPPLHQLWVATKFNG-HH
CYAY_BURCH      ------------------------DGDHDIDLERNGSVLTLTFENGSKIINLQPPMKEVWIAAKAGG-FH
CYAY_BURCC      ------------------------DGDHDIDLERNGSVLTLTFENGSKIINLQPPMKEVWIAAKAGG-FH
CYAY_BURCA      ------------------------DGDHDIDLERNGSVLTLTFENGSKIINLQPPMKEVWIAAKAGG-FH
CYAY_PSEHT      MTDHEYHQLAEALMFTIEEQVD--DCEADLDYESAQGILELIPDNSKIVINKQAPLHQVWVATKFNG-HH
CYAY_BURXL      --------------------------DADIELERSGNVLTLEFERSKIIVNLQPPMSEIWIAAKAGG-FH
CYAY_BORA1      MTETEFLALVEQVLDSVERMADDWAAEQDLDIEANGNVLTLVFEDGTHVINSQAAMQELWLASR-SGGFH
CYAY_BURVG      ------------------------DGDHDIDLERNGSVLTLTFENGSKIINLQPPMKELWIAAKAGG-FH
CYAY_BURCJ      ------------------------DGDHDIDLERNGSVLTLTFENGSKIINLQPPMKEVWIAAKAGG-FH
CYAY_BURPP      --------------------------DADIELERSGNVLTLEFENRTKIINLQPPMSEIWIAAKAGG-FH
CYAY_BORPD      MTETEFLALVDQVLDSIESQAD--DWAASQDVDIEGNVLTLVFEDGTHVVNSQAAMQEIWVAAR-SGGFH
CYAY_VARPS      MTDSEYMDRAEAALAAIEQGCDRINDATDADIDNQGGMITISFKNGSQIVNLQKPLQEIWLAAR-SGGYH
CYAY_BUCAT      ----------------IEDNLNLYENEIDIDYEIQDYVMTITSNKTLIIINKQEPLQQIWLATMQNG-YH
CYAY_BUCAI      ----------------IEDNLNLYENEIDIDYEIQDYVMTITSNKTLIIINKQEPLQQIWLATMQNG-YH
CYAY_BUCA5      ----------------IEDNLNLYENEIDIDYEIQDYVMTITSNKTLIIINKQEPLQQIWLATMQNG-YH
FRDA_ENCCU      -----YHKLADETLTDLSEQLDKELDGGYADYK-DGNLQIKIDNVGEYMFNKQPASMQIWASSPITGPRK
CYAY_SHIFL      MNDSEFHRLADQLWLTIEERLXXXXXXXXXXCEINGGVLTITFENGKIIINRQEPLHQVWLATK-QGGYH
CYAY_DELAS      MTDQEFLDLAERLLLAVEQDCDRINDETDADLDAQGMVTLVFANRSQIVINQQKPLHEIWLAAKAGG-FH
CYAY_RHOFD      MNDLEFMDRAENLLKAVETSCDRINDQTLADIDSQGSMVTLVSNKSQIVINLQKPLHEIWLAAK-SGGYH
CYAY_BORPA      MTETEFLALVDQVLDSIESQAD--DWAAGLDVDIEGNVLTLVFEDGTQVVNAQAAMQELWVAAR-SGGFH
CYAY_BORBR      MTETEFLALVDQVLDSIESQAD--DWAAGLDVDIEGNVLTLVFEDGTQVVNAQAAMQELWVAAR-SGGFH
CYAY_AERS4      MKDHEYHALTDAFFQYVEDTVDAGYPD--IDCERAGGVLTLSFEKTKVIINKQEPLHQIWVATRENG-FH
CYAY_BORPE      MTETEFLALVDQVLDSIESQAD--DWAAGLDVDIEGNVLTLVFEDGTQVVNVQAAMQELWVAAR-SGGFH
CYAY_PSEU5      ----------------VQESVEDVFDDTSLDVDLEGGVLTVRFDNGSQLISRQPALRQLWVAAR-SGGFH
CYAY_DECAR      MDDSEFNALAEQALARIXXXXXXXXXXXXXXXX-PGGVLEIEADRSKIIVNRHSIAKEIWVAARAGG-FH
CYAY_ACIAC      MTDTEFLDHAEKLLLAVEQGCDRINDTTDADLDAQGMVTITFPNRSQIVINLQKPLHEIWMAAQ-SGGYH
CYAY_VIBSL      MNETEFHKLVDIQMQNXXXXXXXXXXXXXXXVT--GNVMTLEFERSQIIINRQEPMREIWLASK-SGGFH
CYAY_SHIF8      MNDSEFHRLADQLWLTIEERLXXXXXXXXXXCEINGGVLTITFENGKIIINRQEPLHQVWLATKQGGS-H
CYAY_CHLT3      -------------------------------------LVSIETEDGTYIVSRQSATNQIWLAEPING-WK
CYAY_AERHH      MKDHEYHALTDAFFQYVEDTVDAGYPD--IDCERAGGVLTLSFEKTKVIINKQEPLHQIWVATRENG-FH
FRDA_TRAHO      ---------AHNTLTALEKKLDNDYGE----IEHNNNVIEYTVDGGRYVVSRQPSVMELWVSSPITGPSK
CYAY_COLP3      --------------------------DSGVDIDYEGGLLTLTKNNSKVIINKQAPLHEIWVATKFNG-HH
CYAY_POLSJ      MTDLEYQDLAESALTAIETACDRINDETDADIDNQGGMITLTSNRSQIIINLQKPLQEIWMAAKAGG-FH
CYAY_BUCBP      ---NEYHTLVNKLFLLIEENIDKNQEKCDIDCEXXXXXXXXXXXXXXQVINKQESLKQIWLATKKNG-YH
CYAY_PSEMY      LSEARFHDLVDAT----QQAVEDIFDDSGLDVDLENSVLTVRFDNGSQLISRQEPIRQLWLAAR-SGGYH
CYAY_BURTA      -------------------------------LERNGSVLTLTFENGSKIINLQPPMKEVWIAAKAGG-FH
CYAY_RALME      -----------------------------VEINRTGNVMELEFEDGSKIINSQAPMQELWVAAKAGG-FH
CYAY_VEREI      MTDLEFMDHAEKLLLAVERSCDRINETTDADLDSQGGMLTLVPNRSQIVINLQKPLHEVWMAAR-SGGYH
CYAY_RALEJ      -----------------------------------GNVMELEFENGKIIINSQAPMQELWVAAR-SGGFH


                         .         .         *         .         .         .         .:140
query           FFYEQGEWTNRAGLELMAILTEELNIKFDTRPT
CYAY_RICCN      FFYEQGEWTNRAGLELMAILTEELNIKFDTRPT
CYAY_RICAE      FFYEQGEWTNRAGLELMAILTEELNIKFDTRPT
CYAY_RICRS      FFYEQGKWTNRAGLELMAILTEELNIKFDTRPT
CYAY_RICRO      FFYEQGKWTNRAGLELMAILTEELNIKFDTRPT
CYAY_RICPU      FCYEQGKWTNRAGLELMAILTEELNIKFDTRPT
CYAY_RICFE      FFYEQGKWKNKIGLELMAILTEELNIKFD----
CYAY_RICPR      FFYEQGKWKSRIGFELMVLLTEELGIRFD----
CYAY_RICTY      FFYEQGKWKSRIGFELMILLTEELGIRFD----
CYAY_RICBR      FFYEQGKWKNRAGLELMSILTDELGIDF-----
CYAY_RICAH      FFYEQGKWKNRVGLELMAILTEELDIDFN----
CYAY_ERWCH      FDYQHGRWCDRSGSDFMALLAQ-----------
CYAY_YERPP      FNYRDGHWCSRSGEEFLAKLSE-----------
CYAY_YERPN      FNYRDGHWCSRSGEEFLAKLSE-----------
CYAY_YERPG      FNYRDGHWCSRSGEEFLAKLSE-----------
CYAY_YERPE      FNYRDGHWCSRSGEEFLAKLSE-----------
CYAY_YERPA      FNYRDGHWCSRSGEEFLAKLSE-----------
CYAY_YERPY      FNYRDGHWCSRSGEEFLAKLSE-----------
CYAY_PHOPR      FKYNNGEWCTRSGEEFFALVKRECSV-------
CYAY_PASMU      FRYQNNNWTSNDGKDFWACLEE-----------
CYAY_VIBVY      FQYKAGQWCSKTGVEFAHMVKQE----------
CYAY_VIBVU      FQYKAGQWCSKTGVEFAHMVKQE----------
CYAY_VIBHB      FKLVDNKWTSKTGMELIAMVKEE----------
CYAY_PHOLL      FDYKEGQWCDRSGDNFLTML-------------
CYAY_YERPS      FNYRDGHWCSRSGEEFFAKLSE-----------
CYAY_YERPB      FNYRDGHWCSRSGEEFFAKLSE-----------
CYAY_YERP3      FNYRDGHWCSRSGEEFFAKLSE-----------
FRDA_ARATH      FDWDR----------------------------
CYAY_EDWI9      FDYRNGQWCSRSGVPLPQVLNE-----------
CYAY_VIBPA      FKLVEDKWTSKTGMELFEMVKQE----------
CYAY_SERP5      FNYRDGVW-------------------------
FRDA_YEAST      FDLLNGEWVSRNGTKLTDILTEEV---------
CYAY_VIBF1      FSYVDEKWTSKTGMEFIEMVKEE----------
FRDA_SCHPO      YEYKSKTWSTRDEGTLLGILSSEFS-KWFSRP-
CYAY_ALISL      FAYTDEKWTSKTGVEFIEMVKEE----------
CYAY_YERE8      FDYREGHWCSRSGEEFFTKLSE-----------
CYAY_VIBFM      FSYVDEKWTSKTGMEFIEMVKEE----------
CYAY_ERWCT      FTLREERWVDRSGEDFIALLS------------
FRDA_MOUSE      YDWTGKNWVSHDGVSLHELLARELTKALNTK--
CYAY_SALPC      FDLKDDEWVDRSG--------------------
CYAY_SALCH      FDLKDDEWVDRSG--------------------
CYAY_SHEON      FGYVEGKWLDRNGGEFMPFVQDSI---------
CYAY_SALAR      FDLKGDEWCDRSGATFWDLLEQ-----------
CYAY_ENTS8      FDYKNDEW-------------------------
CYAY_ACTPJ      FAFRDGEWVTAEGRSFWTHLEE-----------
CYAY_ACTP2      FAFRDGEWVTAEGRSFWTHLEE-----------
CYAY_SALA4      FDLKGDEWVDRSG--------------------
CYAY_BURP8      FRFVDGEWRDRNGTEFYAALSE-----------
CYAY_SHESW      FGFVEGKWLDRNGGEFMPFVQDSI---------
CYAY_SHEPC      FGFVEGKWLDRNGGEFMPFVQDSI---------
CYAY_ESCF3      FDLKGDEW-------------------------
CYAY_SHEB9      FGFVEGKWMDRNGGEFMPFVQESI---------
CYAY_SHEB8      FGFVEGKWMDRNGGEFMPFVQESI---------
CYAY_SHEB5      FGFVEGKWMDRNGGEFMPFVQESI---------
CYAY_SALNS      FDLKDDEWVDRSG--------------------
CYAY_PSYIN      YDYNNGKWDDRSGDEFLTFLS------------
CYAY_KLEP3      FDLKGDEWVDRSG--------------------
CYAY_ACTP7      FAFRDCEWVTAEGRSFWAHLEE-----------
CYAY_YERIN      FNYREGKWCSRSGEEFFAKLSQ-----------
CYAY_SHESR      FGFVDGKWIDRNGGEFMPFVQDSI---------
CYAY_SHESM      FGFVDGKWIDRNGGEFMPFVQDSI---------
CYAY_SHESA      FGFVDGKWIDRNGGEFMPFVQDSI---------
CYAY_SALTY      FDLKGDEWVDRSG--------------------
CYAY_SALTI      FDLKGDEWVDRSG--------------------
CYAY_SALPB      FDLKGDEWCDRSGETFWELLEQ-----------
CYAY_SALG2      FDLKGDEWVDRSG--------------------
CYAY_SALEP      FDLKGDEWVDRSG--------------------
CYAY_SALDC      FDLKGDEWVDRSG--------------------
CYAY_KLEP7      FDLKGDEW-------------------------
FRDA_BOVIN      YDWTGRNWVSHDGVSLHELLATELTQALKTK--
CYAY_SALSV      FDLKGDEW-------------------------
CYAY_SALPK      FDLKGDEWCDRSGETFWELLEQ-----------
CYAY_SALPA      FDLKGDEWCDRSGETFWELLEQ-----------
CYAY_PECCP      FNRQETRWCDRSGEDFITLLS------------
CYAY_CITK8      FDLKGDEW-------------------------
CYAY_ACTSZ      FAWKNNDWVNGQGVRFWDALTE-----------
FRDA_MACFA      YDRTGKNWVSHDGVSLHELLGAELTKALKTK--
CYAY_SHISS      FDLKGDEW-------------------------
CYAY_SHIDS      FDLKGDEW-------------------------
CYAY_SALHS      FDLKGDEW-------------------------
CYAY_ECOSM      FDMKGDEW-------------------------
CYAY_ECOSE      FDLKGDEW-------------------------
CYAY_ECOLU      FDLKGDEW-------------------------
CYAY_ECOLI      FDLKGDEW-------------------------
CYAY_ECOLC      FDLKGDEW-------------------------
CYAY_ECODH      FDLKGDEW-------------------------
CYAY_ECOBW      FDLKGDEW-------------------------
CYAY_ECO8A      FDLKGDEW-------------------------
CYAY_ECO5E      FDLKGDEW-------------------------
CYAY_ECO57      FDLKGDEW-------------------------
CYAY_ECO55      FDLKGDEW-------------------------
CYAY_ECO24      FDLKGDEW-------------------------
CYAY_ECO7I      FDLKGDEW-------------------------
CYAY_SHIBS      FDLKGDEW-------------------------
CYAY_SHIB3      FDLKGDEW-------------------------
CYAY_ECOUT      FDLKGDEW-------------------------
CYAY_ECOL5      FDLKGDEW-------------------------
CYAY_ECOK1      FDLKGDEW-------------------------
CYAY_ECO81      FDLKGDEW-------------------------
CYAY_ECO45      FDLKGDEW-------------------------
CYAY_ECO27      FDLKGDEW-------------------------
CYAY_BURS3      YRFIDGEWRDRTGTEFFSALTE-----------
FRDA_DICDI      FDYDSVEWVNRDGTPLRQLLNSEIN--------
CYAY_ECOHS      FDLKGDEW-------------------------
FRDA_CAEEL      YLEEEGKWTAHDGEQLDSLLNRE----------
CYAY_TOLAT      FDWKDGKWDNRGGRELIELLSD-----------
CYAY_HAEIE      FAFKNGEWVSNDG--------------------
CYAY_ENT38      FNLKGDDW-------------------------
FRDA_HUMAN      YDWTGKNW-------------------------
CYAY_MANSM      FSYKNGDWLNYEG--------------------
CYAY_HAEIN      FAFKNGDWVSNDG--------------------
CYAY_HAEIG      FAFKNGDWVSNDG--------------------
CYAY_HAEI8      FAFKNGDWVSNDG--------------------
CYAY_BURM1      YRYVDGAWRDRTGTEFFAALSE-----------
CYAY_BURCM      YRFVDGEWRDRTGTEFFSALTD-----------
CYAY_BURA4      YRFVDGEWRDRTGTEFFSALTD-----------
FRDA_DROME      YDFAAGRWIKHSGQSLHELLQQEI---------
CYAY_HAES2      FAFKNNQWIAQDG--------------------
CYAY_HAES1      FAFKNNQWIAQDG--------------------
CYAY_JANMA      FKATGTQWINRDGAELFAALSE-----------
CYAY_ECOL6      FDLKGDEW-------------------------
CYAY_NEIMB      FAEQNGKWATRDGRDFYDVLNEALS--------
CYAY_HERAR      FKAQGEQWMNRDATELFAALSQ-----------
CYAY_BURPS      YRFVDGAWRDRSGDEFFAALT------------
CYAY_BURP6      YRFVDGAWRDRSGDEFFAALT------------
CYAY_BURP1      YRFVDGAWRDRSGDEFFAALT------------
CYAY_BURP0      YRFVDGAWRDRSGDEFFAALT------------
CYAY_BURMS      YRFVDGAWRDRSGDEFFAALT------------
CYAY_BURMA      YRFVDGAWRDRSGDEFFAALT------------
CYAY_BURM9      YRFVDGAWRDRSGDEFFAALT------------
CYAY_BURM7      YRFVDGAWRDRSGDEFFAALT------------
CYAY_VIBCM      FKSIDGEWCSKTGLELLTLLKQE----------
CYAY_VIBCH      FKSIDGEWCSKTGLELLTLLKQE----------
CYAY_VIBC3      FKSIDGEWCSKTGLELLTLLKQE----------
CYAY_RALSO      FRRNDGRWVDRSGEELYVALS------------
CYAY_NEIMF      FAEQNGKWATRDSRDFYDVLNEALS--------
CYAY_NEIMA      FAEQNGKWATRDSRDFYDVLNEALS--------
CYAY_NEIM0      FAEQNGKWATRDSRDFYDVLNEALS--------
CYAY_NEIG2      FAEQNGKWATRDSRDFYDVLNEALS--------
CYAY_NEIG1      FAEQNGKWATRDSRDFYDVLNEALS--------
CYAY_BUCAP      FNYKIDKWCNRSNKDFWEIFEKSCSIQ------
CYAY_CHRVO      FSRRGEAWASRDGAEFYATLAEAI---------
CYAY_THISH      FGYDRDAWLNRTGESLTDTLNRVLS--------
CYAY_PSEA6      FNYQDGLWIDRTGVEFWQFMND-----------
CYAY_BURCH      YRFIDGEWRDRTGTEFFSALTE-----------
CYAY_BURCC      YRFIDGEWRDRTGTEFFSALTE-----------
CYAY_BURCA      YRFIDGEWRDRTGTEFFSALTE-----------
CYAY_PSEHT      FELRGDKWDNRSGAEFWQFINE-----------
CYAY_BURXL      FRFVDGEWRDRSGTEFFAALSE-----------
CYAY_BORA1      YRFDGQRWNDTRG--------------------
CYAY_BURVG      YRFVDGEWRDRTGTEFFSALTD-----------
CYAY_BURCJ      YRFIDGEWRDRTGTEFFSALTD-----------
CYAY_BURPP      FRFVDGEWRDRSGTEFFAALSE-----------
CYAY_BORPD      YRYDGQHWNDTRG--------------------
CYAY_VARPS      YRYDGKAWVDKTGEEFFGNLSREASLQ------
CYAY_BUCAT      FDYKNNQWCNRSNKNFWEIFENACSIQ------
CYAY_BUCAI      FDYKNNQWCNRSNKNFWEIFENACSIQ------
CYAY_BUCA5      FNYKNNQWCNRSNKNFWEIFENACSIQ------
FRDA_ENCCU      FICRRHEWIDKSNTSFSRYIEEEL---------
CYAY_SHIFL      FDLKGDEW-------------------------
CYAY_DELAS      YRYDQGAWLDTKG--------------------
CYAY_RHOFD      YKFDNKQWLDTKG--------------------
CYAY_BORPA      YRYDGQHWNDTRG--------------------
CYAY_BORBR      YRYDGQHWNDTRG--------------------
CYAY_AERS4      FELQGETWDNRFGHELKALLTK-----------
CYAY_BORPE      YRYDGQHWNDTRG--------------------
CYAY_PSEU5      FDYDEG---------------------------
CYAY_DECAR      FRWDGASWRDRDNAELMEKLS------------
CYAY_ACIAC      YRLEDGAWKDTKGGEFFAALTRD----------
CYAY_VIBSL      FKLVDDKWTSKTGMALFEMVKEE----------
CYAY_SHIF8      FDLKGDEW-------------------------
CYAY_CHLT3      FNLQDGKWSDKENHELYSFLEALLSQK------
CYAY_AERHH      FELQGESWDNRFGHELKTLLSK-----------
FRDA_TRAHO      FGMVEKKFVEKKGMEIMKYFEMEM---------
CYAY_COLP3      FVLNNDSWTDRSGEEFWQFLSNAVSTQAETELT
CYAY_POLSJ      YKFRGNQW-------------------------
CYAY_BUCBP      FEYINKQWCNRTKKDFWNVLQE-----------
CYAY_PSEMY      FDYDEAE--------------------------
CYAY_BURTA      YRFVDGAWRDRSGDEFFAALT------------
CYAY_RALME      FRNDGSKWVDRGGGELYAALS------------
CYAY_VEREI      YRFDGHAWQDSKGAEFFACLGRDATVQ------
CYAY_RALEJ      FRRDGERWVDRSGDELYAALS------------