[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rcon0:AAL03054.1

[Show Plain Result]


## Summary of Sequence Search
    1::172
 1459::1523    6e-04  38% 5327 aa  MACF1_MOUSE RecName: Full=Microtubule-actin cross-linking factor
    1::172

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxELQKSIQQKEVSNERLTQEEIDNIYKTLGIFEEIKEYEKSDNSRV
MACF1_MOUSE     -------------------------DIEKAILEQQVLAEELTKEQVSEAIKTSQIFHKLSEGEKEQISEQ


                         .         .         *         .         .         .         .:140
query           PRLLNKNYYKLTDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MACF1_MOUSE     LRVLNKTYHDLCD---------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MACF1_MOUSE     --------------------------------