[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rcon0:AAL03106.1

[Show Plain Result]


## Summary of Sequence Search
    1::169
  157::319     2e-25  35% 1024 aa  MDTC_YERPY RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-25  35% 1024 aa  MDTC_YERPS RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-25  35% 1024 aa  MDTC_YERPN RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-25  35% 1024 aa  MDTC_YERPG RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-25  35% 1024 aa  MDTC_YERPE RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-25  35% 1024 aa  MDTC_YERPB RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-25  35% 1024 aa  MDTC_YERPA RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-25  35% 1024 aa  MDTC_YERP3 RecName: Full=Multidrug resistance protein mdtC;AltName:
  168::329     3e-25  32% 1039 aa  MDTB_SERP5 RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     1e-24  31% 1048 aa  MDTB_PHOLL RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     5e-24  31% 1040 aa  MDTB_SALAR RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     7e-24  31% 1040 aa  MDTB_SALTI RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     7e-24  31% 1040 aa  MDTB_SALG2 RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     7e-24  31% 1040 aa  MDTB_SALEP RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     7e-24  31% 1040 aa  MDTB_SALDC RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     9e-24  31% 1040 aa  MDTB_SALTY RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     9e-24  30% 1040 aa  MDTB_SALPK RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     9e-24  31% 1040 aa  MDTB_SALPC RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     9e-24  31% 1040 aa  MDTB_SALPB RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     9e-24  30% 1040 aa  MDTB_SALPA RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     9e-24  30% 1040 aa  MDTB_SALNS RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     9e-24  31% 1040 aa  MDTB_SALHS RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     9e-24  31% 1040 aa  MDTB_SALCH RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     9e-24  31% 1040 aa  MDTB_SALA4 RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     1e-23  30% 1040 aa  MDTB_ECOL5 RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     2e-23  30% 1040 aa  MDTB_SHISS RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     2e-23  30% 1039 aa  MDTB_SHIFL RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     2e-23  30% 1040 aa  MDTB_SHIBS RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     2e-23  30% 1040 aa  MDTB_SHIB3 RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     2e-23  30% 1040 aa  MDTB_ESCF3 RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     2e-23  30% 1040 aa  MDTB_ECOUT RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     2e-23  30% 1040 aa  MDTB_ECOSM RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     2e-23  30% 1040 aa  MDTB_ECOSE RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     2e-23  30% 1040 aa  MDTB_ECOLU RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     2e-23  30% 1040 aa  MDTB_ECOLI RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     2e-23  30% 1040 aa  MDTB_ECOLC RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     2e-23  30% 1040 aa  MDTB_ECOL6 RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     2e-23  30% 1040 aa  MDTB_ECOK1 RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     2e-23  30% 1040 aa  MDTB_ECOHS RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     2e-23  30% 1040 aa  MDTB_ECODH RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     2e-23  30% 1040 aa  MDTB_ECOBW RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     2e-23  30% 1040 aa  MDTB_ECO8A RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     2e-23  30% 1040 aa  MDTB_ECO81 RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     2e-23  30% 1040 aa  MDTB_ECO5E RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     2e-23  30% 1040 aa  MDTB_ECO57 RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     2e-23  30% 1040 aa  MDTB_ECO55 RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     2e-23  30% 1040 aa  MDTB_ECO45 RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     2e-23  30% 1040 aa  MDTB_ECO27 RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     2e-23  30% 1040 aa  MDTB_ECO24 RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     2e-23  30% 1040 aa  MDTB_KLEP7 RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     2e-23  30% 1040 aa  MDTB_KLEP3 RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     5e-23  31% 1052 aa  MDTB_YERPS RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     5e-23  31% 1052 aa  MDTB_YERPE RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     8e-23  30% 1040 aa  MDTB_ECO7I RecName: Full=Multidrug resistance protein mdtB;AltName:
  168::329     1e-22  30% 1040 aa  MDTB_SALSV RecName: Full=Multidrug resistance protein mdtB;AltName:
  157::319     2e-22  32% 1026 aa  MDTC_ERWCT RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-22  32% 1026 aa  MDTC_PECCP RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     3e-21  31% 1024 aa  MDTC_YERE8 RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-20  32% 1024 aa  MDTC_ERWT9 RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-20  33% 1026 aa  MDTC_SALAR RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-20  33% 1029 aa  MDTC_ENTS8 RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     3e-20  33% 1026 aa  MDTC_SERP5 RecName: Full=Multidrug resistance protein mdtC;AltName:
  168::329     6e-20  29% 1040 aa  MDTB_ENTS8 RecName: Full=Multidrug resistance protein mdtB;AltName:
  157::319     2e-19  34% 1025 aa  MDTC_SHISS RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-19  34% 1025 aa  MDTC_SHIBS RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-19  34% 1025 aa  MDTC_SHIB3 RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-19  34% 1025 aa  MDTC_ESCF3 RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-19  34% 1025 aa  MDTC_ECOSE RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-19  34% 1025 aa  MDTC_ECOLU RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-19  34% 1025 aa  MDTC_ECO8A RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-19  34% 1025 aa  MDTC_ECO5E RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-19  34% 1025 aa  MDTC_ECO57 RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-19  34% 1025 aa  MDTC_ECO55 RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-19  34% 1025 aa  MDTC_ECO24 RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-19  33% 1028 aa  MDTC_CITK8 RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-19  33% 1026 aa  MDTC_SALTY RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-19  33% 1026 aa  MDTC_SALTI RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-19  33% 1026 aa  MDTC_SALSV RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-19  33% 1026 aa  MDTC_SALPK RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-19  33% 1026 aa  MDTC_SALPC RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-19  33% 1026 aa  MDTC_SALPB RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-19  33% 1026 aa  MDTC_SALPA RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-19  33% 1026 aa  MDTC_SALNS RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-19  33% 1026 aa  MDTC_SALHS RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-19  33% 1026 aa  MDTC_SALEP RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-19  33% 1026 aa  MDTC_SALDC RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-19  33% 1026 aa  MDTC_SALCH RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-19  33% 1026 aa  MDTC_SALA4 RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-19  33% 1025 aa  MDTC_ECOLI RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-19  33% 1025 aa  MDTC_ECOLC RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-19  34% 1025 aa  MDTC_ECOL5 RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-19  33% 1025 aa  MDTC_ECOHS RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-19  33% 1025 aa  MDTC_ECODH RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-19  33% 1025 aa  MDTC_ECOBW RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     2e-19  34% 1025 aa  MDTC_ECO81 RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     3e-19  34% 1021 aa  MDTC_SHIFL RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     3e-19  34% 1021 aa  MDTC_SHIF8 RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     3e-19  32% 1025 aa  MDTC_ENT38 RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     3e-19  34% 1025 aa  MDTC_ECOUT RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     3e-19  34% 1025 aa  MDTC_ECOL6 RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     3e-19  34% 1025 aa  MDTC_ECOK1 RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     3e-19  34% 1025 aa  MDTC_ECO7I RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     3e-19  34% 1025 aa  MDTC_ECO45 RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     3e-19  34% 1025 aa  MDTC_ECO27 RecName: Full=Multidrug resistance protein mdtC;AltName:
  168::329     3e-19  28% 1040 aa  MDTB_CITK8 RecName: Full=Multidrug resistance protein mdtB;AltName:
  157::319     5e-19  33% 1026 aa  MDTC_SALG2 RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     7e-19  32% 1025 aa  MDTC_KLEP7 RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     7e-19  32% 1025 aa  MDTC_KLEP3 RecName: Full=Multidrug resistance protein mdtC;AltName:
  157::319     9e-19  33% 1025 aa  MDTC_ECOSM RecName: Full=Multidrug resistance protein mdtC;AltName:
  168::329     1e-18  28% 1040 aa  MDTB_ENT38 RecName: Full=Multidrug resistance protein mdtB;AltName:
  171::326     8e-18  28% 1040 aa  MDTB_ERWCT RecName: Full=Multidrug resistance protein mdtB;AltName:
  157::319     1e-16  28% 1036 aa  MDTC_PHOLL RecName: Full=Multidrug resistance protein mdtC;AltName:
  161::325     1e-14  24% 1032 aa  Y895_HAEIN RecName: Full=Uncharacterized transporter HI0895;
  162::323     7e-13  25% 1049 aa  TTGH_PSEPU RecName: Full=Toluene efflux pump membrane transporter
  162::323     7e-13  25% 1049 aa  SRPB_PSEPU RecName: Full=Solvent-resistant pump membrane
  157::310     7e-13  24% 1065 aa  NOLG_RHIME RecName: Full=Nodulation protein nolG;Flags: Precursor;
  168::321     2e-12  23% 1048 aa  SILA_SALTY RecName: Full=Putative cation efflux system protein
  168::319     1e-11  25% 1045 aa  CUSA_ECO57 RecName: Full=Cation efflux system protein cusA;
  168::321     2e-11  24% 1047 aa  CUSA_ECOLI RecName: Full=Cation efflux system protein cusA;
  168::321     2e-11  24% 1047 aa  CUSA_ECOL6 RecName: Full=Cation efflux system protein cusA;
  157::321     4e-11  27% 1050 aa  TTGB_PSEPU RecName: Full=Toluene efflux pump membrane transporter
  157::321     4e-11  27% 1050 aa  TTGB_PSEPK RecName: Full=Probable efflux pump membrane transporter
  157::321     4e-11  27% 1050 aa  MEPB_PSEPU RecName: Full=Multidrug/solvent efflux pump membrane
  157::321     4e-11  27% 1050 aa  ARPB_PSEPU RecName: Full=Antibiotic efflux pump membrane
  157::323     3e-10  26% 1046 aa  MEXB_PSEAE RecName: Full=Multidrug resistance protein mexB;AltName:
  156::321     6e-10  28% 1037 aa  MDTF_ECOL6 RecName: Full=Multidrug resistance protein mdtF;
  156::321     6e-10  28% 1037 aa  MDTF_ECO57 RecName: Full=Multidrug resistance protein mdtF;
  168::322     8e-09  21% 1052 aa  HELA_LEGPN RecName: Full=Protein helA;
  156::327     8e-09  25% 1037 aa  ACRD_ECOLI RecName: Full=Probable aminoglycoside efflux
  170::326     7e-08  23% 1063 aa  CZCA_RALME RecName: Full=Cobalt-zinc-cadmium resistance protein
  170::326     7e-08  23% 1063 aa  CZCA_ALCSC RecName: Full=Cation efflux system protein czcA;
  162::323     9e-08  23% 1046 aa  SEPB_PSEP1 RecName: Full=Probable efflux pump membrane transporter
  156::285     9e-08  29% 1037 aa  MDTF_ECOLI RecName: Full=Multidrug resistance protein mdtF;
  162::325     5e-07  22% 1048 aa  TTGE_PSEPU RecName: Full=Toluene efflux pump membrane transporter
  194::350     2e-04  20% 1076 aa  NCCA_ALCXX RecName: Full=Nickel-cobalt-cadmium resistance protein
  168::233     5e-04  32%  526 aa  EX7L_RHIE6 RecName: Full=Exodeoxyribonuclease 7 large subunit;     
    1::169

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xDYYAETIMAERLSMLPGVAQIQVYGSQQYAVRVQIDPVKMAVNNIGLDQVSNIISSANVNLPTGALYGT
MDTC_YERPY      ---YASTKLAQKIAQTEGVSDVTVGGSSLPAVRVELNPSALFNQGVSLDAVRQAISAANVRRPQGSVDAA
MDTC_YERPS      ---YASTKLAQKIAQTEGVSDVTVGGSSLPAVRVELNPSALFNQGVSLDAVRQAISAANVRRPQGSVDAA
MDTC_YERPN      ---YASTKLAQKIAQTEGVSDVTVGGSSLPAVRVELNPSALFNQGVSLDAVRQAISAANVRRPQGSVDAA
MDTC_YERPG      ---YASTKLAQKIAQTEGVSDVTVGGSSLPAVRVELNPSALFNQGVSLDAVRQAISAANVRRPQGSVDAA
MDTC_YERPE      ---YASTKLAQKIAQTEGVSDVTVGGSSLPAVRVELNPSALFNQGVSLDAVRQAISAANVRRPQGSVDAA
MDTC_YERPB      ---YASTKLAQKIAQTEGVSDVTVGGSSLPAVRVELNPSALFNQGVSLDAVRQAISAANVRRPQGSVDAA
MDTC_YERPA      ---YASTKLAQKIAQTEGVSDVTVGGSSLPAVRVELNPSALFNQGVSLDAVRQAISAANVRRPQGSVDAA
MDTC_YERP3      ---YASTKLAQKIAQTEGVSDVTVGGSSLPAVRVELNPSALFNQGVSLDAVRQAISAANVRRPQGSVDAA
MDTB_SERP5      -----ETRVAQKISQVTGVGLVTISGGQRPAVRVKLNAAAVAAYGLDSETIRTAISNANVNSAKGSLDGP
MDTB_PHOLL      -----ETRIAQKISQVNGVGLVTLAGGQRPAVRVKLNAQAVAAQGLDSETIRTAINNANVNSAKGSLDGP
MDTB_SALAR      -----ETRVAQKISQVSGVGLVTLAGGQRPAVRVKLNAQAIAALGLTSETIRTAITGANVNSAKGSLDGP
MDTB_SALTI      -----ETRVAQKISQVSGVGLVTLAGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_SALG2      -----ETRVAQKISQVSGVGLVTLAGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_SALEP      -----ETRVAQKISQVSGVGLVTLAGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_SALDC      -----ETRVAQKISQVSGVGLVTLAGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_SALTY      -----ETRVAQKISQVSGVGLVTLAGGQRPAVRVKLNAQAVAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_SALPK      -----ETRVAQKISQVSGVGLVTLAGGQRPAIRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_SALPC      -----ETRVAQKISQVSGVGLVTLAGGQRPAVRVKLNAQAVAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_SALPB      -----ETRVAQKISQVSGVGLVTLAGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_SALPA      -----ETRVAQKISQVSGVGLVTLAGGQRPAIRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_SALNS      -----ETRVAQKISQVSGVGLVTLAGGQRPAVRVKLNAQAVAALGLTSETIRTAITGANVNSAKGSLDGP
MDTB_SALHS      -----ETRVAQKISQVSGVGLVTLAGGQRPAVRVKLNAQAVAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_SALCH      -----ETRVAQKISQVSGVGLVTLAGGQRPAVRVKLNAQAVAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_SALA4      -----ETRVAQKISQVSGVGLVTLAGGQRPAVRVKLNAQAVAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_ECOL5      -----ETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSESVRTAITGANVNSAKGSLDGP
MDTB_SHISS      -----ETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_SHIFL      -----ETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_SHIBS      -----ETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_SHIB3      -----ETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_ESCF3      -----ETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_ECOUT      -----ETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_ECOSM      -----ETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_ECOSE      -----ETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_ECOLU      -----ETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_ECOLI      -----ETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_ECOLC      -----ETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_ECOL6      -----ETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_ECOK1      -----ETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_ECOHS      -----ETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_ECODH      -----ETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_ECOBW      -----ETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_ECO8A      -----ETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_ECO81      -----ETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_ECO5E      -----ETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_ECO57      -----ETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_ECO55      -----ETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_ECO45      -----ETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_ECO27      -----ETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_ECO24      -----ETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_KLEP7      -----ETRVAQKISQVSGVGLVTLAGGQRPAVRVKLNAQAIAALGLTSETVRTAITSANVNSAKGSLDGP
MDTB_KLEP3      -----ETRVAQKISQVSGVGLVTLAGGQRPAVRVKLNAQAIAALGLTSETVRTAITSANVNSAKGSLDGP
MDTB_YERPS      -----ETRIAQKISQXXXXXXXXXXXXQRPAVRVKLNAPAVAALGLDSETIRTAISNANVNSAKGSLDGP
MDTB_YERPE      -----ETRIAQKISQXXXXXXXXXXXXQRPAVRVKLNAPAVAALGLDSETIRTAISNANVNSAKGSLDGP
MDTB_ECO7I      -----ETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTSETVRTAITGANVNSAKGSLDGP
MDTB_SALSV      -----ETRVAQKISQVSGVGLVTLAGGQRPAVRVKLNAQAVAALGLTSETVRTAITGANVNSAKGSLDGP
MDTC_ERWCT      ---FASTQLSQKISQMEGVGDVSIGGSSLPAVRVALNPVALFNQGISLDEVRQAIAQANVRQPLGNVENS
MDTC_PECCP      ---FASTQLSQKISQMEGVGDVSIGGSSLPAVRVALNPVALFNQGISLDEVRQAIAQANVRQPLGNVENS
MDTC_YERE8      ---FASTQLAQKIAQTEXXXXXXXXXXXLPAVRVELNPSALFNQGVSLDAVRQAISAANVRRPQGSIDSS
MDTC_ERWT9      ---YASTKLAQRLAQIXXXXXXXXXXSSLPAVRVDLNPQALFNQGVSLDAVRSTIANANVRKPQGAIEDS
MDTC_SALAR      ---FASTQLAQTIAQIXXXXXXXXXXSSLPAVRIGLNPQALFNQGVSLDEVRKAIDSANVRRPQGAIEDN
MDTC_ENTS8      ---YASTQLAQTIAQIXXXXXXXXXXSSLPAVRVALNPQALFNQGVSLDTVRSAISNANVRRPQGAIEDA
MDTC_SERP5      ---FASTQLAQKIAQTEXXXXXXXXXXXLPAVRVELNPSALFNQGISLDAVRQTISNANVRRPQGSVENQ
MDTB_ENTS8      -----ETRVAQRISQXXXXXXXXXXXXQRPAVRVKLNAQALASLGIDSETVRTAITSANVNSAKGSFDGP
MDTC_SHISS      ---FASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDDVRTAISNANVRKPQGALEDG
MDTC_SHIBS      ---FASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDDVRTAISNANVRKPQGALEDG
MDTC_SHIB3      ---FASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDDVRTAISNANVRKPQGALEDG
MDTC_ESCF3      ---FASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDDVRTAISNANVRKPQGALEDG
MDTC_ECOSE      ---FASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDDVRTAISNANVRKPQGALEDG
MDTC_ECOLU      ---FASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDDVRTAISNANVRKPQGALEDG
MDTC_ECO8A      ---FASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDDVRTAISNANVRKPQGALEDG
MDTC_ECO5E      ---FASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDDVRTAISNANVRKPQGALEDG
MDTC_ECO57      ---FASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDDVRTAISNANVRKPQGALEDG
MDTC_ECO55      ---FASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDDVRTAISNANVRKPQGALEDG
MDTC_ECO24      ---FASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDDVRTAISNANVRKPQGALEDG
MDTC_CITK8      ---FASTQLAQTIAQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDDVRSAISNANVRKPQGAIDDK
MDTC_SALTY      ---FASTQLAQTIAQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDEVREAIDSANVRRPQGAIEDS
MDTC_SALTI      ---FASTQLAQTIAQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDEVREAIDSANVRRPQGAIEDS
MDTC_SALSV      ---FASTQLAQTIAQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDEVREAIDSANVRRPQGAIEDS
MDTC_SALPK      ---FASTQLAQTIAQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDEVREAIDSANVRRPQGAIEDS
MDTC_SALPC      ---FASTQLAQTIAQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDEVREAIDSANVRRPQGAIEDS
MDTC_SALPB      ---FASTQLAQTIAQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDEVREAIDSANVRRPQGAIEDS
MDTC_SALPA      ---FASTQLAQTIAQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDEVREAIDSANVRRPQGAIEDS
MDTC_SALNS      ---FASTQLAQTIAQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDEVREAIDSANVRRPQGAIEDS
MDTC_SALHS      ---FASTQLAQTIAQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDEVREAIDSANVRRPQGAIEDS
MDTC_SALEP      ---FASTQLAQTIAQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDEVREAIDSANVRRPQGAIEDS
MDTC_SALDC      ---FASTQLAQTIAQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDEVREAIDSANVRRPQGAIEDS
MDTC_SALCH      ---FASTQLAQTIAQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDEVREAIDSANVRRPQGAIEDS
MDTC_SALA4      ---FASTQLAQTIAQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDEVREAIDSANVRRPQGAIEDS
MDTC_ECOLI      ---FASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDDVRTAVSNANVRKPQGALEDG
MDTC_ECOLC      ---FASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDDVRTAVSNANVRKPQGALEDG
MDTC_ECOL5      ---FASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDDVRTAISNANVRKPQGALEDD
MDTC_ECOHS      ---FASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDDVRTAVSNANVRKPQGALEDG
MDTC_ECODH      ---FASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDDVRTAVSNANVRKPQGALEDG
MDTC_ECOBW      ---FASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDDVRTAVSNANVRKPQGALEDG
MDTC_ECO81      ---FASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDDVRTAISNANVRKPQGALEDD
MDTC_SHIFL      ---FASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLTPQALFNQGVSLDDVRTAISNANVRKPQGALEDG
MDTC_SHIF8      ---FASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLTPQALFNQGVSLDDVRTAISNANVRKPQGALEDG
MDTC_ENT38      ---FASTQLAQTIAQIXXXXXXXXXXSSLPAVRVGLNPEALFNQGVSLDDVRSAISNANVRKPQGAIEDS
MDTC_ECOUT      ---FASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDDVRTAISNANVRKPQGALEDG
MDTC_ECOL6      ---FASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDDVRTAISNANVRKPQGALEDG
MDTC_ECOK1      ---FASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDDVRTAISNANVRKPQGALEDG
MDTC_ECO7I      ---FASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDDVRTAISNANVRKPQGALEDG
MDTC_ECO45      ---FASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDDVRTAISNANVRKPQGALEDG
MDTC_ECO27      ---FASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDDVRTAISNANVRKPQGALEDG
MDTB_CITK8      -----ETRVAQKIXXXXXXXXXXXXXXXRPAVRVKLNAQAIAALGLTSETVRAAITSANVNSAKGSLDGP
MDTC_SALG2      ---FASTQLAQTIAQXXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDEVREAIDSANVRRPQGAIEDS
MDTC_KLEP7      ---FASTQLAQTIAQIXXXXXXXXXXSSLPAVRVDLNPQALFNQGVSLDAVRTAISDANVRKPQGALEDS
MDTC_KLEP3      ---FASTQLAQTIAQIXXXXXXXXXXSSLPAVRVDLNPQALFNQGVSLDAVRTAISDANVRKPQGALEDS
MDTC_ECOSM      ---FASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSLDDVRTAISNANVRKPQGVLEDG
MDTB_ENT38      -----ETRVAQKIXXXXXXXXXXXXXXXRPAVRVKLNAQAIAALGLTSETIRTAIVSANVNSAKGSLDGP
MDTB_ERWCT      --------IAQKISQXXXXXXXXXXXXQRPAVRVRLNAPALAAYGLTSETIRTAITAANVNSAKGSLDGP
MDTC_PHOLL      ---FASTQLAQKIAQXXXXXXXXXXXXXLPAVRVELNPGVLFHQGVSLDAVRKAISNANVRRPQGYVDSE
Y895_HAEIN      ---YINRVVKPQFFTIEGVAEVQVFGAAEYALRIWLDPQKMAAQNLSVPTVMSALSANNVQTAAGNDNGY
TTGH_PSEPU      --------LQDPISRIPGVGDFQLFGSP-YAMRIWLDPGKLNSYQLTPTDVASAIREQNVQVSSGQLSGV
SRPB_PSEPU      --------LQDPISRIPGVGDFQLFGSP-YAMRIWLDPGKLNSYQLTPTDVASAIREQNVQVSSGQLSGV
NOLG_RHIME      ----ATRVINNRLSVISGVGQVSLIGSSERQVLVVVDPDRLGAYGLAVSTVIEAIRGENQDRAAGTLISG
SILA_SALTY      ------------LKTIPNVAEVASVGGVVKQYQIQVNPVKLSQYGISLPEVKQALESSNQEAGGSSVEIA
CUSA_ECO57      ------------LKTIPDVAEVASVGGVVKEYQVVIDPQRLAQYGISLAEVKSALDASNQEAGGSSIELA
CUSA_ECOLI      ------------LKTIPDVAEVASVGGVVKEYQVVIDPQRLAQYGISLAEVKSALDASNQEAGGSSIELA
CUSA_ECOL6      ------------LKTIPDVAEVASVGGVVKEYQVVIDPQRLAQYGISLAEVKSALDASNQEAGGSSIELA
TTGB_PSEPU      ---YIVSNMQDPISRTAGVGDFQVFGAQ-YAMRIWLDPAKLNKFQLTPVDVKTAVAAQNVQVSSGALPGT
TTGB_PSEPK      ---YIVSNMQDPISRTAGVGDFQVFGAQ-YAMRIWLDPAKLNKFQLTPVDVKTAVAAQNVQVSSGALPGT
MEPB_PSEPU      ---YIVSNMQDPISRTAGVGDFQVFGAQ-YAMRIWLDPAKLNKFQLTPVDVKTAVAAQNVQVSSGALPGT
ARPB_PSEPU      ---YIVSNMQDPISRTAGVGDFQVFGAQ-YAMRIWLDPAKLNKFQLTPVDVKTAVAAQNVQVSSGALPGT
MEXB_PSEAE      ---YIVSNIQDPLSRTKGVGDFQVFGSQ-YSMRIWLDPAKLNSYQLTPGDVSSAIQAQNVQISSGAVKGQ
MDTF_ECOL6      -DYVASNIK-DPLSRTAGVGSVQLFGSE-YAMRIWLDPQKLNKYNLVPSDVISQIKVQNNQISGGQLGGQ
MDTF_ECO57      -DYVASNIK-DPLSRTAGVGSVQLFGSE-YAMRIWLDPQKLNKYNLVPSDVISQIKVQNNQISGGQLGGQ
HELA_LEGPN      -------IIKPQLRNVEGVAEVNTIGGYEKQFHITPDPSKLVRYRLSLNDVVEALERNNANVGAGYIETN
ACRD_ECOLI      -DYVASNIQ-DPLSRVNGVGDIDAYGSQ-YSMRIWLDPAKLNSFQMTAKDVTDAIESQNAQIAVGQLGGT
CZCA_RALME      -------VVRPQLRNVPGVTEINTIGNKQYLVAPSLE--RLASYGLTLTDVVNALNKNNDNVGAGYIERR
CZCA_ALCSC      -------VVRPQLRNVPGVTEINTIGNKQYLVAPSLE--RLASYGLTLTDVVNALNKNNDNVGAGYIERR
SEPB_PSEP1      --------LQDPISRINGVGDFLLFGSP-YAMRIWLDPGKLNSYQLTPGDVAQAIREQNVQVSSGQLSGV
MDTF_ECOLI      -DYVASNIK-DPLSRTAGVGSVQLFGSE-YAMRIWLDPQKLNKYNLVPSDVISQIKVQNNQISGGQLGGQ
TTGE_PSEPU      --------LQDPISRINGVGDFLLFGSP-YAMRIWLDPGKLNSYQLTPGDVAQAIREQNVQVSSGQLSGV
NCCA_ALCXX      -------IIRPQLRTTAGVADVDSLGGYVKQFVVEPDAAKMAAYGISFEELAQALEDANLSVGANFIRRS
EX7L_RHIE6      --------------------------SDRFPVHVLVWPVKVQGEGAG-DEVANAIRGFNALEPGGAIARP


                         .         .         *         .         .         .         .:140
query           DIYSSIRAPGQLQNVKEYNELILTYKNGNPLFLKNIGKTIDSVANNKIAAWYRDKPGVILAIQKQPDTTN
MDTC_YERPY      ETHWQVQANDEIKTAEGYRPLIVHYNNGSPVRLQDVANVIDSVQDVRNAGMSAGQPAVLLVISREPG-AN
MDTC_YERPS      ETHWQVQANDEIKTAEGYRPLIVHYNNGSPVRLQDVANVIDSVQDVRNAGMSAGQPAVLLVISREPG-AN
MDTC_YERPN      ETHWQVQANDEIKTAEGYRPLIVHYNNGSPVRLQDVANVIDSVQDVRNAGMSAGQPAVLLVISREPG-AN
MDTC_YERPG      ETHWQVQANDEIKTAEGYRPLIVHYNNGSPVRLQDVANVIDSVQDVRNAGMSAGQPAVLLVISREPG-AN
MDTC_YERPE      ETHWQVQANDEIKTAEGYRPLIVHYNNGSPVRLQDVANVIDSVQDVRNAGMSAGQPAVLLVISREPG-AN
MDTC_YERPB      ETHWQVQANDEIKTAEGYRPLIVHYNNGSPVRLQDVANVIDSVQDVRNAGMSAGQPAVLLVISREPG-AN
MDTC_YERPA      ETHWQVQANDEIKTAEGYRPLIVHYNNGSPVRLQDVANVIDSVQDVRNAGMSAGQPAVLLVISREPG-AN
MDTC_YERP3      ETHWQVQANDEIKTAEGYRPLIVHYNNGSPVRLQDVANVIDSVQDVRNAGMSAGQPAVLLVISREPG-AN
MDTB_SERP5      TRSVTLSANDQMKSADDYRQLIVAYQNGAAIRLQDIATIEQGAENTRLAAWANKQPAIVLNIQRQPG-VN
MDTB_PHOLL      TRSVTLSANDQMKSVNDYRNLIIAYKNGSPVRLQDVATIEQGAENTKLGAWSNNTQAIVINVQRQPG-AN
MDTB_SALAR      ERAVTLSANDQMQSADEYRRLIIAYKNGAPVRLGDVATVEQGAENSWLGAWANKAPAIVMNVQRQPG-AN
MDTB_SALTI      ERAVTLSANDQMQSADEYRKLIIAYQNGAPVRLGDVATVEQGAENSWLGAWANQAPAIVMNVQRQPG-AN
MDTB_SALG2      ERAVTLSANDQMQSADEYRKLIIAYQNGAPVRLGDVATVEQGAENSWLGAWANQAPAIVMNVQRQPG-AN
MDTB_SALEP      ERAVTLSANDQMQSADEYRKLIIAYQNGAPVRLGDVATVEQGAENSWLGAWANQAPAIVMNVQRQPG-AN
MDTB_SALDC      ERAVTLSANDQMQSADEYRKLIIAYQNGAPVRLGDVATVEQGAENSWLGAWANQAPAIVMNVQRQPG-AN
MDTB_SALTY      ERAVTLSANDQMQSADEYRRLIIAYQNGAPVRLGDVATVEQGAENSWLGAWANQAPAIVMNVQRQPG-AN
MDTB_SALPK      ERAVTLSANDQMQSADEYRKLIIAYQNGAPVRLGDVATVEQGAENSWLGAWANQAPAIVMNVQRQPG-AN
MDTB_SALPC      ERAVTLSANDQMQSADEYRRLIIAYQNGAPVRLGDVATVEQGAENSWLGAWANQAPAIVMNVQRQPG-AN
MDTB_SALPB      ERAVTLSANDQMQSADEYRRLIIAYQNGAPVRLGDVATVEQGAENSWLGAWANQAPAIVMNVQRQPG-AN
MDTB_SALPA      ERAVTLSANDQMQSADEYRKLIIAYQNGAPVRLGDVATVEQGAENSWLGAWANQAPAIVMNVQRQPG-AN
MDTB_SALNS      ERAVTLSANDQMQSADEYRKLIIAYQNGAPVRLGDVATVEQGAENSWLGAWANQAPAIVMNVQRQPG-AN
MDTB_SALHS      ERAVTLSANDQMQSADEYRRLIIAYQNGAPVRLGDVATVEQGAENSWLGAWANQAPAIVMNVQRQPG-AN
MDTB_SALCH      ERAVTLSANDQMQSADEYRRLIIAYQNGAPVRLGDVATVEQGAENSWLGAWANQAPAIVMNVQRQPG-AN
MDTB_SALA4      ERAVTLSANDQMQSADEYRRLIIAYQNGAPVRLGDVATVEQGAENSWLGAWANQAPAIVMNVQRQPG-AN
MDTB_ECOL5      SRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQPG-AN
MDTB_SHISS      SRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQPG-AN
MDTB_SHIFL      SRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQPG-AN
MDTB_SHIBS      SRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQPG-AN
MDTB_SHIB3      SRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQPG-AN
MDTB_ESCF3      SRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQPG-AN
MDTB_ECOUT      SRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQPG-AN
MDTB_ECOSM      SRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQPG-AN
MDTB_ECOSE      SRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQPG-AN
MDTB_ECOLU      SRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQPG-AN
MDTB_ECOLI      SRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQPG-AN
MDTB_ECOLC      SRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQPG-AN
MDTB_ECOL6      SRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQPG-AN
MDTB_ECOK1      SRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQPG-AN
MDTB_ECOHS      SRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQPG-AN
MDTB_ECODH      SRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQPG-AN
MDTB_ECOBW      SRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQPG-AN
MDTB_ECO8A      SRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQPG-AN
MDTB_ECO81      SRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQPG-AN
MDTB_ECO5E      SRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQPG-AN
MDTB_ECO57      SRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQPG-AN
MDTB_ECO55      SRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQPG-AN
MDTB_ECO45      SRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQPG-AN
MDTB_ECO27      SRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQPG-AN
MDTB_ECO24      SRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQPG-AN
MDTB_KLEP7      ARAVTLSANDQMQSAEDYRRLIIAYQNGAPIRLGDVASVEQGAENSWLGAWANQQRAIVMNVQRQPG-AN
MDTB_KLEP3      ARAVTLSANDQMQSAEDYRRLIIAYQNGAPIRLGDVASVEQGAENSWLGAWANQQRAIVMNVQRQPG-AN
MDTB_YERPS      TRSVTLSANDQMKSAEEYRDLIIAYQNGAPIRLQDVATIEQGAENNKLAAWANTQSAIVLNIQRQPG-VN
MDTB_YERPE      TRSVTLSANDQMKSAEEYRDLIIAYQNGAPIRLQDVATIEQGAENNKLAAWANTQSAIVLNIQRQPG-VN
MDTB_ECO7I      SRAVTLSANDQMQSAEEYRQLIIAYQNSAPIRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQPG-AN
MDTB_SALSV      ERAVTLSANDQMQSADDYRRLIIAYQNGAPVRLGDVATVEQGAENSWLGAWANQAPANVMNVQRQPG-AN
MDTC_ERWCT      QKRWQIQTNDELKTADAYAPLIIHYSNGAAVRLSDVATVEDSVQNSRNAGMANSKPAILVMIRRAPD-AN
MDTC_PECCP      QKSWQIKTNDELKTADAYAPLIIHYNNGAAVRLSDVATVEDSVQNSRNAGMANAKPAILVMIRRAPD-AN
MDTC_YERE8      EQHWQVQANDEIKTAEGYRPLIIHYNNGSPVRLQDVANIVDSVQDVRNAGMSDGKPAVLLVISREPG-AN
MDTC_ERWT9      QLRWWIKTNDELHTAAEYRPLVIHYRNGAAVRLQDVATVTDSVQDVRNAGMSNARPAVLLVIRKSPQ-AN
MDTC_SALAR      VHRWQIQTNDELKTAAEYQPLIIHYKNGAAVRLDDVASVTDSVQDVRNAGMTNAKPAILLMIRKLPE-TN
MDTC_ENTS8      QRRWQLQTNDELKTAAEYEPLIVHYNNGAAVHLRDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_SERP5      QQRWQIQANDELKTAEVYRPLIIHYNNGSAVRLSDVAEVNDSVQDVRNAGMTNAKPAIILTISRAPD-AN
MDTB_ENTS8      ERAVTLSANDQMKSADEYRNLIIAYKNGAPVRLGDVATVEQGAENAWLGAWANKQPAIVMNVQRQPG-AN
MDTC_SHISS      THRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_SHIBS      THRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_SHIB3      THRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_ESCF3      THRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_ECOSE      THRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_ECOLU      THRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_ECO8A      THRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_ECO5E      THRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_ECO57      THRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_ECO55      THRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_ECO24      THRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_CITK8      THRWQVQTNDELKTATEYQPLIIHYNNGAAVRLGDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_SALTY      VHRWQIQTNDELKTAAEYQPLIIHYNNGAAVRLGDVASVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_SALTI      VHRWQIQTNDELKTAAEYQPLIIHYNNGAAVRLGDVASVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_SALSV      VHRWQIQTNDELKTAAEYQPLIIHYNNGAAVRLGDVASVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_SALPK      VHRWQIQTNDELKTAAEYQPLIIHYNNGAAVRLGDVASVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_SALPC      VHRWQIQTNDELKTAAEYQPLIIHYNNGAAVRLGDVASVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_SALPB      VHRWQIQTNDELKTAAEYQPLIIHYNNGAAVRLGDVASVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_SALPA      VHRWQIQTNDELKTAAEYQPLIIHYNNGAAVRLGDVASVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_SALNS      VHRWQIQTNDELKTAAEYQPLIIHYNNGAAVRLGDVASVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_SALHS      VHRWQIQTNDELKTAAEYQPLIIHYNNGAAVRLGDVASVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_SALEP      VHRWQIQTNDELKTAAEYQPLIIHYNNGAAVRLGDVASVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_SALDC      VHRWQIQTNDELKTAAEYQPLIIHYNNGAAVRLGDVASVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_SALCH      VHRWQIQTNDELKTAAEYQPLIIHYNNGAAVRLGDVASVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_SALA4      VHRWQIQTNDELKTAAEYQPLIIHYNNGAAVRLGDVASVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_ECOLI      THRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_ECOLC      THRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_ECOL5      THRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_ECOHS      THRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_ECODH      THRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_ECOBW      THRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_ECO81      THRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_SHIFL      THRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_SHIF8      THRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_ENT38      SHRWQIQTNDELKTAAEYQPLIIHYNNGAAVRLSDVASVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_ECOUT      THRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_ECOL6      THRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_ECOK1      THRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_ECO7I      THRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_ECO45      THRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_ECO27      THRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTB_CITK8      TRAVTLSANDQMQSVDEYRQLIIAWQNGAPVRLGDVATVEQGAENSWLGAWANKEQAIVMNVQRQPG-AN
MDTC_SALG2      VHRWQIQTNDELKTAAEYQPLIIHYNNGAAVRLGDVASVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_KLEP7      AHRWQVQTNDELKTAADYQPLIVHYQNGAAVRLGDVATVSDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_KLEP3      AHRWQVQTNDELKTAADYQPLIVHYQNGAAVRLGDVATVSDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTC_ECOSM      THRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRNAGMTNAKPAILLMIRKLPE-AN
MDTB_ENT38      TRAVTLSANDQMQSADEYRQLIVAYQNGAPIRLGDVATVEQGAENRWLGAWANKEQAIVMNVQRQPG-AN
MDTB_ERWCT      TRSVTLSANDQMKSVDDYRKLIVAWKNGAPVRLQDVATIEQAAENIYLGAWANRQQAIIINVQRQPG-AN
MDTC_PHOLL      QQHWQIQMNDELKTAENYRPIIVHYNNNSPVRLQDVANVKDSVQNVRAAGMSGGEPAILLIIRREAG-AN
Y895_HAEIN      YVSYRNKVETTTKSVEQLSNLIISSNGDDLVRLRDIATVELNKENDNSRATANGAESVVLAI-NPTSTAN
TTGH_PSEPU      QLNATVLGKTRMTTPSQFDEILVKVNDGSQVRVKDVGRAELGADSFAISAQYKDSPTASLALRLSTG-GN
SRPB_PSEPU      QLNATVLGKTRMTTPSQFDEILVKVNDGSQVRVKDVGRAELGADSFAISAQYKDSPTASLALRLSTG-GN
NOLG_RHIME      INQRIVTVEGRIANTSGFNRIIVAQRNGYPVYLSEVATILDTGAEVTSLANYQGQTTLGLHIVK-VQGAN
SILA_SALTY      EAEYMVRASGYLQSIDDFNNIVLTGENGVPVYLRDVARVQTGPEMRRGIAELNGQGEVAGGVVILRSGKN
CUSA_ECO57      EAEYMVRASGYLQTLDDFNHIVLASENGVPVYLRDVAKQVGPEMRRGIAELNGEVVGGVVILR---SGKN
CUSA_ECOLI      EAEYMVRASGYLQTLDDFNHIVLASENGVPVYLRDVAKVQIGPEMRRGIAELNGEGEVAGGVVILRSGKN
CUSA_ECOL6      EAEYMVRASGYLQTLDDFNHIVLASENGVPVYLRDVAKVQVGPEMRRGIAELNGEGEVAGGVVILRSGKN
TTGB_PSEPU      QLNATIIGKTRLQTAEQFESILLVNKDGSQVRLGDVAQVGLGGENYAVSAQFNGKPASGLAV-KLATGAN
TTGB_PSEPK      QLNATIIGKTRLQTAEQFESILLVNKDGSQVRLGDVAQVGLGGENYAVSAQFNGKPASGLAV-KLATGAN
MEPB_PSEPU      QLNATIIGKTRLQTAEQFESILLVNKDGSQVRLGDVAQVGLGGENYAVSAQFNGKPASGLAV-KLATGAN
ARPB_PSEPU      QLNATIIGKTRLQTAEQFESILLVNKDGSQVRLGDVAQVGLGGENYAVSAQFNGKPASGLAV-KLATGAN
MEXB_PSEAE      QLNATIIGKTRLQTAEQFENILLKVNDGSQVRLKDVADVGLGGQDYSINAQFNGSPASGIAI-KLATGAN
MDTF_ECOL6      QLNASIIVQTRLQTPEEFGKILLVQQDGSQVLLRDVARVELGAEDYSTVARYNGKPAAGIAI-KLATGAN
MDTF_ECO57      QLNASIIVQTRLQTPEEFGKILLVQQDGSQVLLRDVARVELGAEDYSTVARYNGKPAAGIAI-KLATGAN
HELA_LEGPN      GEQNLIRVPGQVQNMADIENIVIASFEGTPVRIRDVAEVALGKELRTGAATENSKEGTVFILMGENSRTV
ACRD_ECOLI      PLNATINAQSLLQTPEQFRDITLVNQDGSEVRLGDVATVEMGAEKYDYLSRFNGKPASGLGV-KLASGAN
CZCA_RALME      GEQYLVRAPGQVASEDDIRNIIVGTAQGQPIRIRDIG-DVEIGKELRTGAATENGKEVVLGTVFMLIGEN
CZCA_ALCSC      GEQYLVRAPGQVASEDDIRNIIVGTAQGQPIRIRDIG-DVEIGKELRTGAATENGKEVVLGTVFMLIGEN
SEPB_PSEP1      QLNATVVGKTRMTTPAEFEEILVKVKDGSQVRVKDLGRVVLASENFAISAKYRGQ-DXXXXXXXXXXXXX
MDTF_ECOLI      QLNASIIVQTRLQTPEEFGKILLVQQDGSQVLLRDVARVELGAEDYSTVARYNGKP--------------
TTGE_PSEPU      QLNATVVGKTRMTTPAEFEEILVKVKDGSQVRVKDLDRVVLASENFAISAKYRGQDSAXXXXXXXXXXXX
NCCA_ALCXX      GESYLVRADARIKSADEIARAVIAQRQGVPI-------TVGQVANINVGAASRNGYETVVGSALMLVGAN
EX7L_RHIE6      DVLIVARGGGSLEDLWSFNDEIV-----------------------------------------------


                         +         .         .         .         .         *         .:210
query           TIEIVDSIKEVLPLLRRQIPEGININIMF
MDTC_YERPY      IIATVDRIRAELPALRASIPASIQLNI--
MDTC_YERPS      IIATVDRIRAELPALRASIPASIQLNI--
MDTC_YERPN      IIATVDRIRAELPALRASIPASIQLNI--
MDTC_YERPG      IIATVDRIRAELPALRASIPASIQLNI--
MDTC_YERPE      IIATVDRIRAELPALRASIPASIQLNI--
MDTC_YERPB      IIATVDRIRAELPALRASIPASIQLNI--
MDTC_YERPA      IIATVDRIRAELPALRASIPASIQLNI--
MDTC_YERP3      IIATVDRIRAELPALRASIPASIQLNI--
MDTB_SERP5      VITTADSIREMLPQLIKSLPKSVDVKVL-
MDTB_PHOLL      VIETTDNIRQMLPELISSLPKSVDMKIL-
MDTB_SALAR      IIATADSIRQMLPQLTESLPKSVKVTVL-
MDTB_SALTI      IIATADSIRQMLPQLTESLPKSVKVTVL-
MDTB_SALG2      IIATADSIRQMLPQLTESLPKSVKVTVL-
MDTB_SALEP      IIATADSIRQMLPQLTESLPKSVKVTVL-
MDTB_SALDC      IIATADSIRQMLPQLTESLPKSVKVTVL-
MDTB_SALTY      IIATADSIRQMLPQLTESLPKSVKVTVL-
MDTB_SALPK      IIATADSIRQMLPQLTESLPKSVKVTVL-
MDTB_SALPC      IIATADSIRQMLPQLTESLPKSVKVTVL-
MDTB_SALPB      IIATADSIRQMLPQLTESLPKSVKVTVL-
MDTB_SALPA      IIATADSIRQMLPQLTESLPKSVKVTVL-
MDTB_SALNS      IIATADSIRQMLPQLTESLPKSVKVTVL-
MDTB_SALHS      IIATADSIRQMLPQLTESLPKSVKVTVL-
MDTB_SALCH      IIATADSIRQMLPQLTESLPKSVKVTVL-
MDTB_SALA4      IIATADSIRQMLPQLTESLPKSVKVTVL-
MDTB_ECOL5      IISTADSIRQMLPQLTESLPKSVKVTVL-
MDTB_SHISS      IISTADSIRQMLPQLTESLPKSVKVTVL-
MDTB_SHIFL      IISTADSIRQMLPQLTESLPKSVKVTVL-
MDTB_SHIBS      IISTADSIRQMLPQLTESLPKSVKVTVL-
MDTB_SHIB3      IISTADSIRQMLPQLTESLPKSVEVTVL-
MDTB_ESCF3      IISTADSIRQMLPQLTESLPKSVKVTVL-
MDTB_ECOUT      IISTADSIRQMLPQLTESLPKSVKVTVL-
MDTB_ECOSM      IISTADSIRQMLPQLTESLPKSVKVTVL-
MDTB_ECOSE      IISTADSIRQMLPQLTESLPKSVKVTVL-
MDTB_ECOLU      IISTADSIRQMLPQLTESLPKSVKVTVL-
MDTB_ECOLI      IISTADSIRQMLPQLTESLPKSVKVTVL-
MDTB_ECOLC      IISTADSIRQMLPQLTESLPKSVKVTVL-
MDTB_ECOL6      IISTADSIRQMLPQLTESLPKSVKVTVL-
MDTB_ECOK1      IISTADSIRQMLPQLTESLPKSVKVTVL-
MDTB_ECOHS      IISTADSIRQMLPQLTESLPKSVKVTVL-
MDTB_ECODH      IISTADSIRQMLPQLTESLPKSVKVTVL-
MDTB_ECOBW      IISTADSIRQMLPQLTESLPKSVKVTVL-
MDTB_ECO8A      IISTADSIRQMLPQLTESLPKSVKVTVL-
MDTB_ECO81      IISTADSIRQMLPQLTESLPKSVKVTVL-
MDTB_ECO5E      IISTADSIRQMLPQLTESLPKSVKVTVL-
MDTB_ECO57      IISTADSIRQMLPQLTESLPKSVKVTVL-
MDTB_ECO55      IISTADSIRQMLPQLTESLPKSVKVTVL-
MDTB_ECO45      IISTADSIRQMLPQLTESLPKSVKVTVL-
MDTB_ECO27      IISTADSIRQMLPQLTESLPKSVKVTVL-
MDTB_ECO24      IISTADSIRQMLPQLTESLPKSVKVTVL-
MDTB_KLEP7      IIDTADSIRQMLPQLTESLPKSVKVQVL-
MDTB_KLEP3      IIDTADSIRQMLPQLTESLPKSVKVQVL-
MDTB_YERPS      VIATADSIREMLPELIKSLPKSVDVKVL-
MDTB_YERPE      VIATADSIREMLPELIKSLPKSVDVKVL-
MDTB_ECO7I      IISTADSIRQMLPQLTESLPKSVKVTVL-
MDTB_SALSV      IIATADSIRQMLPQLTESLPKSVKVTVL-
MDTC_ERWCT      IITTVDNIRAAMPELRASLPAEIQLDV--
MDTC_PECCP      IITTVDNIRAAMPELRASLPAEIQLDV--
MDTC_YERE8      IIATVDRIRAELPALRASIPASIELNI--
MDTC_ERWT9      IIDTVDRIRGEVPELRNTLPASIGLDI--
MDTC_SALAR      IIQTVDSIRAKLPELQAMIPAAIDLQI--
MDTC_ENTS8      IIETVDRIRAALPELRDTIPAAIDMQI--
MDTC_SERP5      IIETVDRIRAELPTLQNNIPASIQLNI--
MDTB_ENTS8      IITTAETIQKLLPQLTESLPKSVQVKVL-
MDTC_SHISS      IIQTVDSIRAKLPELQETIPAAIDLQI--
MDTC_SHIBS      IIQTVDSIRAKLPELQETIPAAIDLQI--
MDTC_SHIB3      IIQTVDSIRAKLPELQETIPAAIDLQI--
MDTC_ESCF3      IIQTVDSIRAKLPELQETIPAAIDLQI--
MDTC_ECOSE      IIQTVDSIRAKLPELQETIPAAIDLQI--
MDTC_ECOLU      IIQTVDSIRAKLPELQETIPAAIDLQI--
MDTC_ECO8A      IIQTVDSIRAKLPELQETIPAAIDLQI--
MDTC_ECO5E      IIQTVDSIRAKLPELQETIPAAIDLQI--
MDTC_ECO57      IIQTVDSIRAKLPELQETIPAAIDLQI--
MDTC_ECO55      IIQTVDSIRAKLPELQETIPAAIDLQI--
MDTC_ECO24      IIQTVDSIRAKLPELQETIPAAIDLQI--
MDTC_CITK8      IIQTVDSIREKLPELQTLIPASIDLQI--
MDTC_SALTY      IIQTVDGIRAKLPELRAMIPAAIDLQI--
MDTC_SALTI      IIQTVDGIRAKLPELRAMIPAAIDLQI--
MDTC_SALSV      IIQTVDGIRAKLPELRAMIPAAIDLQI--
MDTC_SALPK      IIQTVDGIRAKLPELRAMIPAAIDLQI--
MDTC_SALPC      IIQTVDGIRAKLPELRAMIPAAIDLQI--
MDTC_SALPB      IIQTVDGIRAKLPELRAMIPAAIDLQI--
MDTC_SALPA      IIQTVDGIRAKLPELRAMIPAAIDLQI--
MDTC_SALNS      IIQTVDGIRAKLPELRAMIPAAIDLQI--
MDTC_SALHS      IIQTVDGIRAKLPELRAMIPAAIDLQI--
MDTC_SALEP      IIQTVDGIRAKLPELRAMIPAAIDLQI--
MDTC_SALDC      IIQTVDGIRAKLPELRAMIPAAIDLQI--
MDTC_SALCH      IIQTVDGIRAKLPELRAMIPAAIDLQI--
MDTC_SALA4      IIQTVDGIRAKLPELRAMIPAAIDLQI--
MDTC_ECOLI      IIQTVDSIRAKLPELQETIPAAIDLQI--
MDTC_ECOLC      IIQTVDSIRAKLPELQETIPAAIDLQI--
MDTC_ECOL5      IIQTVDSIRARLPELQSTIPAAIDLQI--
MDTC_ECOHS      IIQTVDSIRAKLPELQETIPAAIDLQI--
MDTC_ECODH      IIQTVDSIRAKLPELQETIPAAIDLQI--
MDTC_ECOBW      IIQTVDSIRAKLPELQETIPAAIDLQI--
MDTC_ECO81      IIQTVDSIRARLPELQSTIPAAIDLQI--
MDTC_SHIFL      IIQTVDSIRAKLPELQETIPAAIDLQI--
MDTC_SHIF8      IIQTVDSIRAKLPELQETIPAAIDLQI--
MDTC_ENT38      IIQTVNSIRARLPELQETIPAAIDLQI--
MDTC_ECOUT      IIQTVDSIRARLPELQSTIPAAIDLQI--
MDTC_ECOL6      IIQTVDSIRARLPELQSTIPAAIDLQI--
MDTC_ECOK1      IIQTVDSIRARLPELQSTIPAAIDLQI--
MDTC_ECO7I      IIQTVDSIRARLPELQSTIPAAIDLQI--
MDTC_ECO45      IIQTVDSIRARLPELQSTIPAAIDLQI--
MDTC_ECO27      IIQTVDSIRARLPELQSTIPAAIDLQI--
MDTB_CITK8      IISTADSIRQMLPQLTESLPKSVNVTVL-
MDTC_SALG2      IIQTVDGIRAKLPELRAMIPAAIDLQI--
MDTC_KLEP7      IIQTVDSIRARLPELQQTIPAAIDLQI--
MDTC_KLEP3      IIQTVDSIRARLPELQQTIPAAIDLQI--
MDTC_ECOSM      IIQTVDSIRARLPELQSTIPAAIDLQI--
MDTB_ENT38      IIDTADSIRAMLPQLIESLPKSVNVKVL-
MDTB_ERWCT      VITTTDSINKMLPALKASLPNSVEV----
MDTC_PHOLL      IIATVNRIREQLPALHESIPASIQLKV--
Y895_HAEIN      PLTVAEKIRPLYESIKTQLPDSMESDILY
TTGH_PSEPU      LLETVDAVKKLMEQQKAYLPDGVEV----
SRPB_PSEPU      LLETVDAVKKLMEQQKAYLPDGVEV----
NOLG_RHIME      TVEVASAVRREVSALNAEL----------
SILA_SALTY      ARDVITAVRDKLETLKASLPEGVEI----
CUSA_ECO57      AREVIAAVKDKLETLKSSLPEGVEI----
CUSA_ECOLI      AREVIAAVKDKLETLKSSLPEGVEI----
CUSA_ECOL6      AREVIAAVKDKLETLKSSLPEGVEI----
TTGB_PSEPU      ALDTAKALRETIKGLEPFFPPGV------
TTGB_PSEPK      ALDTAKALRETIKGLEPFFPPGV------
MEPB_PSEPU      ALDTAKALRETIKGLEPFFPPGV------
ARPB_PSEPU      ALDTAKALRETIKGLEPFFPPGV------
MEXB_PSEAE      ALDTAKAIRQTIANLEPFMPQGMKV----
MDTF_ECOL6      ALDTSRAVKEELNRLSAYFPASL------
MDTF_ECO57      ALDTSRAVKEELNRLSAYFPASL------
HELA_LEGPN      SERVAAKMKDI----NKTLPEGV------
ACRD_ECOLI      EMATAELVLNRLDELAQYFPHGLEYKVAY
CZCA_RALME      SRAVSKAVDEKVASINRTMPEGVKI----
CZCA_ALCSC      SRAVSKAVDEKVASINRTMPEGVKI----
SEPB_PSEP1      XXETVKAVKAELEKQKAYLPEGVEV----
MDTF_ECOLI      -----------------------------
TTGE_PSEPU      XXETVKAVKAELEKQKAYLPEGVEV----
NCCA_ALCXX      SRTVAQAVGDKLEEIKKTLPPGVVI----
EX7L_RHIE6      -----------------------------